Clone Name | bastl40g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chai... | 28 | 4.7 | 2 | RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chai... | 28 | 4.7 |
---|
>RBS2_CHLRE (P08475) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 185 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 183 FASTRCL--DGQRWLVLKQDLFGSKPRISTPREIPICDDIWPE 61 F S CL D + W + K +FG + + REI C +P+ Sbjct: 105 FGSVSCLYYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPD 147
>RBS1_CHLRE (P00873) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 185 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 2/43 (4%) Frame = -3 Query: 183 FASTRCL--DGQRWLVLKQDLFGSKPRISTPREIPICDDIWPE 61 F S CL D + W + K +FG + + REI C +P+ Sbjct: 105 FGSVSCLYYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPD 147 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,687,663 Number of Sequences: 219361 Number of extensions: 522232 Number of successful extensions: 1661 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1661 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)