| Clone Name | bastl40g08 |
|---|---|
| Clone Library Name | barley_pub |
>DLGP3_HUMAN (O95886) Disks large-associated protein 3 (DAP-3)| (SAP90/PSD-95-associated protein 3) (SAPAP3) (PSD-95/SAP90-binding protein 3) Length = 979 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 265 PPASAATPGPWRAPTPSP 212 PPA+ +PGP APTP P Sbjct: 749 PPATDGSPGPAPAPTPGP 766
>PTN23_MOUSE (Q6PB44) Tyrosine-protein phosphatase non-receptor type 23 (EC| 3.1.3.48) Length = 1692 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -1 Query: 265 PPASAATPGPWRAPTPSPS 209 PPAS TP P P+P+PS Sbjct: 1129 PPASQPTPSPHLVPSPAPS 1147
>GCNL2_MOUSE (Q9JHD2) General control of amino acid synthesis protein 5-like 2| (EC 2.3.1.48) (Histone acetyltransferase GCN5) (mmGCN5) Length = 830 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 262 PASAATPGPWRAPTPSPS 209 PASA+TP P AP P+P+ Sbjct: 34 PASASTPAPTPAPAPAPA 51
>RL31B_PASMU (Q9CP41) 50S ribosomal protein L31 type B| Length = 88 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = +1 Query: 151 PVFACDASNATLAAYGFCNRKATASARARDLVSR 252 PVF CD S+A+ Y R+ RA D V+R Sbjct: 45 PVFMCDTSSASHPYYTGKTRQIANEGRASDFVNR 78
>PCBB_PROMA (Q9L8M5) Divinyl chlorophyll a/b light-harvesting protein pcbB| Length = 349 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +1 Query: 112 WWGGNAGTAEAQAPVFACDASNATLAAYG 198 WW GN+G A A++ L A+G Sbjct: 13 WWAGNSGVTNRSGKFIAAHAAHTGLIAFG 41
>IGHA1_HUMAN (P01876) Ig alpha-1 chain C region| Length = 353 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 262 PASAATPGPWRAPTPSPSGC 203 P++ TP P PTPSPS C Sbjct: 104 PSTPPTPSPSTPPTPSPSCC 123
>GP1_CHLRE (Q9FPQ6) Vegetative cell wall protein gp1 precursor| (Hydroxyproline-rich glycoprotein 1) Length = 555 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 268 SPPASAATPGPWRAPTPSPS 209 SPP S A P P +P+PSPS Sbjct: 333 SPPPSPAPPTPSPSPSPSPS 352
>SFPQ_MOUSE (Q8VIJ6) Splicing factor, proline- and glutamine-rich| (Polypyrimidine tract-binding protein-associated splicing factor) (PTB-associated splicing factor) (PSF) (DNA-binding p52/p100 complex, 100 kDa subunit) Length = 699 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -1 Query: 268 SPPASAATPGPWRAPTPSPS 209 +PP + A PGP PTP P+ Sbjct: 131 NPPTTGAPPGPGPTPTPPPA 150
>RANB9_HUMAN (Q96S59) Ran-binding protein 9 (RanBP9) (RanBP7) (Ran-binding| protein M) (RanBPM) (BPM90) (BPM-L) Length = 729 Score = 23.9 bits (50), Expect(2) = 7.6 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 79 PGTVGAPPTPLLLAG 35 PG G PTP L+AG Sbjct: 112 PGPAGGAPTPALVAG 126 Score = 22.3 bits (46), Expect(2) = 7.6 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -1 Query: 265 PPASAATPGPWRAPTPSPS 209 PPA+AA P P P P S Sbjct: 76 PPATAAPPPPPPPPPPPAS 94 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.126 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,543,998 Number of Sequences: 219361 Number of extensions: 252006 Number of successful extensions: 2279 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2260 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)