| Clone Name | bastl40e04 |
|---|---|
| Clone Library Name | barley_pub |
>ATXR5_ARATH (Q8VZJ1) Histone-lysine N-methyltransferase ATXR5 (EC 2.1.1.43)| (Trithorax-related protein 5) (TRX-related protein 5) (Protein SET DOMAIN GROUP 15) Length = 352 Score = 32.7 bits (73), Expect = 0.24 Identities = 19/64 (29%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +2 Query: 92 PLVREAEDLRRRREMDDVCDECGDVGYSHLLLRCSNCNNAARHRYCLDEINFDLAV-EWL 268 P+V + E+ + C++CG LL C C+ H CL I + + WL Sbjct: 49 PVVEQEEEEDEDSYSNVTCEKCGSGEGDDELLLCDKCDRGF-HMKCLRPIVVRVPIGTWL 107 Query: 269 CSDC 280 C DC Sbjct: 108 CVDC 111
>UHRF2_MOUSE (Q7TMI3) Ubiquitin-like PHD and RING finger domain-containing| protein 2 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 2) (Np95-like ring finger protein) (Nuclear zinc finger protein Np97) (NIRF) Length = 803 Score = 32.0 bits (71), Expect = 0.41 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +2 Query: 146 CDECGDVGYSHLLLRCSNCNNAARHRYCLDEINFDLAVE--WLCSDCIPKHSEAI 304 C +CG+ ++ L C C N A H YCL + E W C C SE + Sbjct: 348 CHKCGEKRDPNMQLLCDEC-NMAYHIYCLSPPLDKVPEEEYWYCPSCKTDSSEVV 401
>PKL_ARATH (Q9S775) CHD3-type chromatin remodeling factor PICKLE (EC 3.6.1.-)| (Protein GYMNOS) Length = 1384 Score = 31.6 bits (70), Expect = 0.53 Identities = 21/71 (29%), Positives = 32/71 (45%), Gaps = 1/71 (1%) Frame = +2 Query: 89 DPLVREAEDLRRRREMDDVCDECGDVGYSHLLLRCSNCNNAARHRYCLDEINFDLAVE-W 265 D + E + R ++ C CG+ S L+ C+ C A H CL D +VE W Sbjct: 33 DRTFEQVEAIVRTDAKENACQACGE---STNLVSCNTCTYAF-HAKCLVPPLKDASVENW 88 Query: 266 LCSDCIPKHSE 298 C +C+ +E Sbjct: 89 RCPECVSPLNE 99
>ATXR6_ARATH (Q9FNE9) Histone-lysine N-methyltransferase ATXR6 (EC 2.1.1.43)| (Trithorax-related protein 6) (TRX-related protein 6) (Protein SET DOMAIN GROUP 34) Length = 349 Score = 31.2 bits (69), Expect = 0.70 Identities = 19/58 (32%), Positives = 24/58 (41%), Gaps = 5/58 (8%) Frame = +2 Query: 131 EMDDVCDECGDVGYSHLLLRCSNCNNAARHRYCLDEINFDLAV-EWLCSDC----IPK 289 + D VC+EC LL C C+ H +CL I + W C C IPK Sbjct: 30 DWDTVCEECSSGKQPAKLLLCDKCDKGF-HLFCLRPILVSVPKGSWFCPSCSKHQIPK 86
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 30.8 bits (68), Expect = 0.91 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 143 VCDECGDVGYSHLLLRCSNCNNAARHRYCLDEINFDLAV-EWLCSDCI 283 VC+ CG LL C +C + + H YCLD + W C C+ Sbjct: 1154 VCEVCGQASDPSRLLLCDDC-DISYHTYCLDPPLLTVPKGGWKCKWCV 1200
>BAZ1A_XENLA (Q8UVR5) Bromodomain adjacent to zinc finger domain 1A| (ATP-utilizing chromatin assembly and remodely factor 1) (xACF1) (Fragment) Length = 627 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 146 CDECGDVGYSHLLLRCSNCNNAARHRYCL-DEINFDLAVEWLCSDCIPK 289 C C G ++ C C+ H YC+ ++ + +W C +C PK Sbjct: 225 CKVCRKKGDGESMVLCDGCDRG-HHIYCVRPKLKYVPEGDWFCPECHPK 272
>MLL3_MOUSE (Q8BRH4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) Length = 4903 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 143 VCDECGDVGYSHLLLRCSNCNNAARHRYCLD-EINFDLAVEWLCSDCI 283 VC+ CG LL C +C + + H YCLD + W C C+ Sbjct: 1002 VCEACGKATDPGRLLLCDDC-DISYHTYCLDPPLQTVPKGGWKCKWCV 1048
>TIF1A_HUMAN (O15164) Transcription intermediary factor 1-alpha (TIF1-alpha)| (Tripartite motif protein 24) (RING finger protein 82) Length = 1050 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 191 CSNC-NNAARHRYCLDEINFDLAVEWLCSDCIPKH 292 C++C +NA + +C++ VEWLC CI H Sbjct: 163 CTSCEDNAEANGFCVE------CVEWLCKTCIRAH 191
>RPC2_YEAST (P22276) DNA-directed RNA polymerase III 130 kDa polypeptide (EC| 2.7.7.6) (C128) (RNA polymerase III subunit 2) Length = 1149 Score = 29.3 bits (64), Expect = 2.6 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +2 Query: 140 DVCDECGDVGYSHLLLRCSNCNN 208 DVCD+CG +GYS C + N Sbjct: 1093 DVCDKCGLMGYSGWCTTCKSAEN 1115
>MLL3_HUMAN (Q8NEZ4) Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog| (Histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3) (EC 2.1.1.43) (Homologous to ALR protein) Length = 4911 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 143 VCDECGDVGYSHLLLRCSNCNNAARHRYCLD-EINFDLAVEWLCSDCI 283 VC+ CG LL C +C + + H YCLD + W C C+ Sbjct: 1009 VCEACGKATDPGRLLLCDDC-DISYHTYCLDPPLQTVPKGGWKCKWCV 1055
>TIF1A_MOUSE (Q64127) Transcription intermediary factor 1-alpha (TIF1-alpha)| (Tripartite motif protein 24) Length = 1051 Score = 29.3 bits (64), Expect = 2.6 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 191 CSNC-NNAARHRYCLDEINFDLAVEWLCSDCIPKH 292 C++C +NA + +C++ VEWLC CI H Sbjct: 163 CTSCEDNAEANGFCVE------CVEWLCKTCIRAH 191
>EGFR_DROME (P04412) Epidermal growth factor receptor precursor (EC 2.7.10.1)| (Egfr) (Gurken receptor) (Protein torpedo) (Drosophila relative of ERBB) Length = 1426 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/57 (26%), Positives = 24/57 (42%) Frame = +2 Query: 128 REMDDVCDECGDVGYSHLLLRCSNCNNAARHRYCLDEINFDLAVEWLCSDCIPKHSE 298 R+ +C+ C + GY + CS C + R C E D + +C +H E Sbjct: 738 RKCHPLCELCTNYGYHEQV--CSKCTHYKRREQCETECPADHYTDEEQRECFQRHPE 792
>ESR1_ICTPU (Q9YHZ7) Estrogen receptor (ER) (Estradiol receptor) (ER-alpha)| Length = 617 Score = 28.9 bits (63), Expect = 3.5 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 4/30 (13%) Frame = -3 Query: 155 TRRTHHPSRGAS--SDLP--PPGLEDHPKP 78 T THHPS G++ +DLP PPG P P Sbjct: 588 TTTTHHPSNGSTCPADLPSNPPGPGQSPSP 617
>KPC2_DROME (P13677) Protein kinase C, eye isozyme (EC 2.7.11.13) (PKC)| (dPKC53E(EY)) (Protein INAC) (Inactivation no after-potential C protein) (Photoreceptor-specific PKC) (Eye-PKC) Length = 700 Score = 28.9 bits (63), Expect = 3.5 Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 2/27 (7%) Frame = +2 Query: 146 CDECGDV--GYSHLLLRCSNCNNAARH 220 CDECG + G +H ++C NCN H Sbjct: 150 CDECGLLLHGVAHQGVKCENCNLNVHH 176
>JHD1_CANAL (Q5A847) JmjC domain-containing histone demethylation protein 1 (EC| 1.14.11.-) Length = 478 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +2 Query: 185 LRCSNCNNAARHRYCLD--EINFDLAVEWLCSDCIPKHSEA 301 ++CS C H +CLD D V + C +C+PK+ E+ Sbjct: 33 IQCSKCK-VWYHVHCLDLPTDEIDQIVIYHCPECVPKYGES 72
>PRH_PETCR (P48786) Pathogenesis-related homeodomain protein (PRHP)| Length = 1088 Score = 28.5 bits (62), Expect = 4.5 Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 8/64 (12%) Frame = +2 Query: 113 DLRRRREMDDV-CDECG--DVGYSHLLLRCSNCNNAARHRYCLDEINFDLAVE-----WL 268 D R + +D+ C +CG DV S+ ++ C + H++CLD + WL Sbjct: 569 DSRGEIDSEDIFCAKCGSKDVTLSNDIILCDGACDRGFHQFCLDPPLLKEYIPPDDEGWL 628 Query: 269 CSDC 280 C C Sbjct: 629 CPGC 632
>CHD3_DROME (O16102) Chromodomain helicase-DNA-binding protein 3 (EC 3.6.1.-)| (ATP-dependent helicase Chd3) Length = 892 Score = 28.5 bits (62), Expect = 4.5 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 137 DDVCDECGDVGYSHLLLRCSNCNNAARHRYCLDEINFDLAV-EWLCSDCIPKHSEA 301 ++ C C D G LL C +C + HR CL + +W+C CIP +A Sbjct: 35 EEYCKVCSDGGD---LLCCDSCPSVY-HRTCLSPPLKSIPKGDWICPRCIPLPGKA 86
>BAZ1A_HUMAN (Q9NRL2) Bromodomain adjacent to zinc finger domain protein 1A| (ATP-utilizing chromatin assembly and remodeling factor 1) (hACF1) (ATP-dependent chromatin remodelling protein) (Williams syndrome transcription factor-related chromatin remodeli Length = 1556 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +2 Query: 146 CDECGDVGYSHLLLRCSNCNNAARHRYCL-DEINFDLAVEWLCSDCIPK 289 C C G + ++ C C+ H YC+ ++ +W C +C PK Sbjct: 1151 CKICRKKGDAENMVLCDGCDRG-HHTYCVRPKLKTVPEGDWFCPECRPK 1198
>PHF10_XENLA (Q63ZP1) PHD finger protein 10| Length = 417 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +2 Query: 167 GYSHLLLRCSNCNNAARHRYCLDEINFDLAV----EWLCSDC 280 G S L+ CS C+N+ H CLD +AV W C +C Sbjct: 312 GRSERLIHCSQCDNSG-HPSCLDMSAELVAVIKKYPWQCMEC 352
>LIN49_CAEEL (Q20318) Protein lin-49 (Abnormal cell lineage protein 49)| Length = 1042 Score = 27.7 bits (60), Expect = 7.7 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = +2 Query: 131 EMDDVCDEC--GDVGYSHLLLRCSNCNNAARHRYC 229 E+DDVC+ C GD + ++ C CN + H+ C Sbjct: 193 ELDDVCNICLDGDTSNCNQIVYCDRCNLSV-HQDC 226
>ATX2_ARATH (Q9MA43) Histone-lysine N-methyltransferase ATX2 (EC 2.1.1.43)| (Trithorax-homolog protein 2) (TRX-homolog protein 2) (Protein SET DOMAIN GROUP 30) Length = 1193 Score = 27.7 bits (60), Expect = 7.7 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 2/51 (3%) Frame = +2 Query: 140 DVCDECG-DVGY-SHLLLRCSNCNNAARHRYCLDEINFDLAVEWLCSDCIP 286 D C+ C D Y ++L L+C C H C ++ + WLC+ C P Sbjct: 589 DKCNVCHMDEEYENNLFLQCDKCRMMV-HTRCYGQLEPHNGILWLCNLCRP 638
>VWF_CANFA (Q28295) Von Willebrand factor precursor (vWF)| Length = 2813 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/58 (29%), Positives = 24/58 (41%) Frame = +2 Query: 131 EMDDVCDECGDVGYSHLLLRCSNCNNAARHRYCLDEINFDLAVEWLCSDCIPKHSEAI 304 E DVC C D+ S + LR + C+ CL + L C C+P E + Sbjct: 2446 EACDVCT-CTDLEDSVMGLRVAQCSQKPCEDNCLSGFTYVLHEGECCGRCLPSACEVV 2502 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,138,644 Number of Sequences: 219361 Number of extensions: 442540 Number of successful extensions: 1589 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 1555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1589 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)