Clone Name | bastl40c09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TILS_PROMM (Q7V987) tRNA(Ile)-lysidine synthase (EC 6.3.4.-) (tR... | 32 | 0.76 | 2 | D1IP_HUMAN (Q9NYX4) D1 dopamine receptor-interacting protein cal... | 28 | 8.4 |
---|
>TILS_PROMM (Q7V987) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 343 Score = 32.0 bits (71), Expect = 0.76 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = +3 Query: 27 IPTRSHLTWLWLEPASRPSAPAMREEVRSSSAAPADPP 140 I R+ L WL+ + PS PA++ E S S AP PP Sbjct: 282 ITARTTLLAYWLKRSGAPSLPAVQLEQISQSIAPGKPP 319
>D1IP_HUMAN (Q9NYX4) D1 dopamine receptor-interacting protein calcyon| Length = 217 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +3 Query: 30 PTRSHLTWLWLEPASRPSAPAMREEVRSSSAAPADPP 140 PT++ EP +PSA A +E R ++ + A PP Sbjct: 179 PTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPP 215 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,617,171 Number of Sequences: 219361 Number of extensions: 858351 Number of successful extensions: 2691 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2598 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2685 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)