Clone Name | bastl40c01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2) | 44 | 1e-04 | 2 | NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3) | 44 | 1e-04 | 3 | NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5) | 44 | 1e-04 | 4 | RABE2_HUMAN (Q9H5N1) Rab GTPase-binding effector protein 2 (Raba... | 28 | 4.6 |
---|
>NOMO2_HUMAN (Q5JPE7) Nodal modulator 2 precursor (pM5 protein 2)| Length = 1267 Score = 43.9 bits (102), Expect = 1e-04 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = +3 Query: 108 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPN-GYYLIPI 284 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN GY++IP+ Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPL 82
>NOMO3_HUMAN (P69849) Nodal modulator 3 precursor (pM5 protein 3)| Length = 1222 Score = 43.9 bits (102), Expect = 1e-04 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = +3 Query: 108 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPN-GYYLIPI 284 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN GY++IP+ Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPL 82
>NOMO1_HUMAN (Q15155) Nodal modulator 1 precursor (pM5)| Length = 1222 Score = 43.9 bits (102), Expect = 1e-04 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%) Frame = +3 Query: 108 DEIDGCGGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPN-GYYLIPI 284 D + GCGGFV+ S+ + +YS I ++L T G +K T CAPN GY++IP+ Sbjct: 34 DIVVGCGGFVK-----------SDVEINYSLIEIKLYTKHGTLKYQTDCAPNNGYFMIPL 82
>RABE2_HUMAN (Q9H5N1) Rab GTPase-binding effector protein 2 (Rabaptin-5beta)| Length = 569 Score = 28.5 bits (62), Expect = 4.6 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +3 Query: 126 GGFVEASSGLAKSRRASESKFDYSDITVELCTVDGLVKESTQCAPNGYYLIP 281 GG V +SS L +SR+ + + T L + LV E P GY L+P Sbjct: 240 GGGVGSSSSLPQSRQGLSPE---QEETASLVSTGTLVPEGIYLPPPGYQLVP 288 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,407,303 Number of Sequences: 219361 Number of extensions: 353089 Number of successful extensions: 750 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 737 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 747 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)