ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl40b08 |
|---|---|
| Clone Library Name | barley_pub |
>UBP42_HUMAN (Q9H9J4) Ubiquitin carboxyl-terminal hydrolase 42 (EC 3.1.2.15)| (Ubiquitin thioesterase 42) (Ubiquitin-specific-processing protease 42) (Deubiquitinating enzyme 42) Length = 1325 Score = 112 bits (279), Expect = 5e-25 Identities = 47/95 (49%), Positives = 63/95 (66%) Frame = +1 Query: 148 RIGAGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTAL 327 R+GAGLQNLGNTC+ N+ LQCLTYT P A Y+ S H +C GFC +C +Q H+ AL Sbjct: 108 RVGAGLQNLGNTCFANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQAL 167 Query: 328 QSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 + G ++ P ++ +R I+R FR QEDAHE + Sbjct: 168 SNPGDVIKPMFVINEMRRIARHFRFGNQEDAHEFL 202
>UBP36_HUMAN (Q9P275) Ubiquitin carboxyl-terminal hydrolase 36 (EC 3.1.2.15)| (Ubiquitin thioesterase 36) (Ubiquitin-specific-processing protease 36) (Deubiquitinating enzyme 36) Length = 1121 Score = 111 bits (278), Expect = 7e-25 Identities = 48/95 (50%), Positives = 63/95 (66%) Frame = +1 Query: 148 RIGAGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTAL 327 R+GAGL NLGNTC+LN+ +QCLTYT P A YL S H SC FC LC +QNH+ A Sbjct: 119 RVGAGLHNLGNTCFLNATIQCLTYTPPLANYLLSKEHARSCHQGSFCMLCVMQNHIVQAF 178 Query: 328 QSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 ++G + P +++L+ I+R FR QEDAHE + Sbjct: 179 ANSGNAIKPVSFIRDLKKIARHFRFGNQEDAHEFL 213
>UBPW_MOUSE (Q61068) Ubiquitin carboxyl-terminal hydrolase DUB-1 (EC 3.1.2.15)| (Ubiquitin thioesterase DUB-1) (Ubiquitin-specific processing protease DUB-1) (Deubiquitinating enzyme 1) Length = 526 Score = 79.7 bits (195), Expect = 3e-15 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 2/95 (2%) Frame = +1 Query: 154 GAGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTAL-- 327 G GLQN GN+CYLN+ LQCLT+T P A Y+ S H +C + C LCA++ V +L Sbjct: 50 GCGLQNTGNSCYLNAALQCLTHTPPLADYMLSQEHSQTCCSPEGCKLCAMEALVTQSLLH 109 Query: 328 QSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 +G ++ PS I ++ +F +QEDAHE + Sbjct: 110 SHSGDVMKPSHI------LTSAFHKHQQEDAHEFL 138
>UBP12_HUMAN (O75317) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) (Ubiquitin hydrolyzing enzyme 1) Length = 355 Score = 56.6 bits (135), Expect = 3e-08 Identities = 36/95 (37%), Positives = 47/95 (49%), Gaps = 4/95 (4%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF----AAYLQSGRHKSSCRTAGFCALCALQNHVKTAL 327 GL N GNTCY NSVLQ L + PF AY R K S T L L + + T Sbjct: 25 GLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLT----CLADLFHSIATQK 80 Query: 328 QSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 + G ++ P + + LR + F N Q+DAHE + Sbjct: 81 KKVG-VIPPKKFITRLRKENELFDNYMQQDAHEFL 114
>UBP6_HUMAN (P35125) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) (Proto-oncogene TRE-2) Length = 1406 Score = 55.5 bits (132), Expect = 6e-08 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 6/97 (6%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRH------KSSCRTAGFCALCALQNHVKT 321 GL NLGNTC++NS +QC++ T+P Y SGRH + G A C + V+ Sbjct: 533 GLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKC-YGDLVQE 591 Query: 322 ALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 T K V P ++ + + + F +Q+D+ EL+ Sbjct: 592 LWSGTQKSVAPLKLRRTIAKYAPKFDGFQQQDSQELL 628
>UBP2_MOUSE (O88623) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 353 Score = 54.3 bits (129), Expect = 1e-07 Identities = 33/98 (33%), Positives = 50/98 (51%), Gaps = 6/98 (6%) Frame = +1 Query: 157 AGLQNLGNTCYLNSVLQCLTYTEPF------AAYLQSGRHKSSCRTAGFCALCALQNHVK 318 AGL+NLGNTC++NS+LQCL+ T Y++ H SS TA L + Sbjct: 15 AGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLGHTSSAHTALMEEFAKLIQTIW 74 Query: 319 TALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 T+ S +V+PS+ ++ + F Q+DA E + Sbjct: 75 TS--SPNDVVSPSEFKTQIQRYAPRFMGYNQQDAQEFL 110
>UBP4_ARATH (Q8LAM0) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (AtUBP4) Length = 365 Score = 54.3 bits (129), Expect = 1e-07 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 2/93 (2%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYL--QSGRHKSSCRTAGFCALCALQNHVKTALQS 333 G +N GNTCY NSVLQ L + PF L +K+ L L + + + + Sbjct: 24 GFENFGNTCYCNSVLQALYFCAPFREQLLEHYANNKADAEENLLTCLADLFSQISSQKKK 83 Query: 334 TGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 TG ++ P + V+ L+ + FR+ +DAHE + Sbjct: 84 TG-VIAPKRFVQRLKKQNELFRSYMHQDAHEFL 115
>UBP46_MOUSE (P62069) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 53.9 bits (128), Expect = 2e-07 Identities = 30/91 (32%), Positives = 46/91 (50%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQSTG 339 GL N GNTCY NSVLQ L + PF + + + + + L L + + T + G Sbjct: 36 GLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKKKENLLTCLADLFHSIATQKKKVG 95 Query: 340 KIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 ++ P + + LR + F N Q+DAHE + Sbjct: 96 -VIPPKKFISRLRKENDLFDNYMQQDAHEFL 125
>UBP46_HUMAN (P62068) Ubiquitin carboxyl-terminal hydrolase 46 (EC 3.1.2.15)| (Ubiquitin thioesterase 46) (Ubiquitin-specific-processing protease 46) (Deubiquitinating enzyme 46) Length = 366 Score = 53.9 bits (128), Expect = 2e-07 Identities = 30/91 (32%), Positives = 46/91 (50%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQSTG 339 GL N GNTCY NSVLQ L + PF + + + + + L L + + T + G Sbjct: 36 GLVNFGNTCYCNSVLQALYFCRPFRENVLAYKAQQKKKENLLTCLADLFHSIATQKKKVG 95 Query: 340 KIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 ++ P + + LR + F N Q+DAHE + Sbjct: 96 -VIPPKKFISRLRKENDLFDNYMQQDAHEFL 125
>UBP32_HUMAN (Q8NFA0) Ubiquitin carboxyl-terminal hydrolase 32 (EC 3.1.2.15)| (Ubiquitin thioesterase 32) (Ubiquitin-specific-processing protease 32) (Deubiquitinating enzyme 32) (NY-REN-60 antigen) Length = 1604 Score = 53.5 bits (127), Expect = 2e-07 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRH------KSSCRTAGFCALCALQNHVKT 321 GL NLGNTC++NS +QC++ T+P Y SGRH + G A C + V+ Sbjct: 735 GLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKC-YGDLVQE 793 Query: 322 ALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 T K V P ++ + + F +Q+D+ EL+ Sbjct: 794 LWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELL 830
>UBP3_ARATH (O24454) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) (AtUBP3) Length = 371 Score = 53.5 bits (127), Expect = 2e-07 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 4/95 (4%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQ----CLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTAL 327 G +N GNTCY NSVLQ C+ + E Y S + + L L + + + Sbjct: 24 GFENFGNTCYCNSVLQALYFCVPFREQLLEYYTSNKSVADAEENLMTCLADLFSQISSQK 83 Query: 328 QSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 + TG ++ P + V+ L+ + FR+ +DAHE + Sbjct: 84 KKTG-VIAPKRFVQRLKKQNELFRSYMHQDAHEFL 117
>UBP2_HUMAN (O75604) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 605 Score = 52.4 bits (124), Expect = 5e-07 Identities = 32/98 (32%), Positives = 50/98 (51%), Gaps = 6/98 (6%) Frame = +1 Query: 157 AGLQNLGNTCYLNSVLQCLTYTEPF------AAYLQSGRHKSSCRTAGFCALCALQNHVK 318 AGL+NLGNTC++NS+LQCL+ T Y++ H S+ TA L + Sbjct: 267 AGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIW 326 Query: 319 TALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 T+ S +V+PS+ ++ + F Q+DA E + Sbjct: 327 TS--SPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFL 362
>UBP22_MOUSE (Q5DU02) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 51.6 bits (122), Expect = 8e-07 Identities = 25/91 (27%), Positives = 45/91 (49%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQSTG 339 GL NLGNTC++N ++Q LT+T + S RH+ ++ C +C + + + Sbjct: 177 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHR 236 Query: 340 KIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 P +++ + +R Q+DAHE + Sbjct: 237 SPHIPYKLLHLVWTHARHLAGYEQQDAHEFL 267
>UBP22_HUMAN (Q9UPT9) Ubiquitin carboxyl-terminal hydrolase 22 (EC 3.1.2.15)| (Ubiquitin thioesterase 22) (Ubiquitin-specific-processing protease 22) (Deubiquitinating enzyme 22) Length = 525 Score = 51.6 bits (122), Expect = 8e-07 Identities = 25/91 (27%), Positives = 45/91 (49%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQSTG 339 GL NLGNTC++N ++Q LT+T + S RH+ ++ C +C + + + Sbjct: 177 GLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMSSLFQEFYSGHR 236 Query: 340 KIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 P +++ + +R Q+DAHE + Sbjct: 237 SPHIPYKLLHLVWTHARHLAGYEQQDAHEFL 267
>UBP3_MOUSE (Q91W36) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 520 Score = 50.1 bits (118), Expect = 2e-06 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 15/106 (14%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQ------------SGRHKSSCRTAGFCALCAL 303 GL+NLGNTC++N++LQ L+ E F Y + +GR R+ G + + Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDSNVSLV 219 Query: 304 QNHVKTAL---QSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 + KT Q + +P + + I +FR +Q+DAHE M Sbjct: 220 EEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHEFM 265
>UBP51_HUMAN (Q70EK9) Ubiquitin carboxyl-terminal hydrolase 51 (EC 3.1.2.15)| (Ubiquitin thioesterase 51) (Ubiquitin-specific-processing protease 51) (Deubiquitinating enzyme 51) Length = 711 Score = 49.7 bits (117), Expect = 3e-06 Identities = 24/91 (26%), Positives = 43/91 (47%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQSTG 339 GL NLGNTC++N ++Q LT+ + S +HK + C +C + + + Sbjct: 364 GLINLGNTCFMNCIVQALTHIPLLKDFFLSDKHKCIMTSPSLCLVCEMSSLFHAMYSGSR 423 Query: 340 KIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 P +++ + + RQ+DAHE + Sbjct: 424 TPHIPYKLLHLIWIHAEHLAGYRQQDAHEFL 454
>UBP2_CHICK (O57429) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (41 kDa ubiquitin-specific protease) Length = 357 Score = 49.3 bits (116), Expect = 4e-06 Identities = 32/97 (32%), Positives = 49/97 (50%), Gaps = 6/97 (6%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFA------AYLQSGRHKSSCRTAGFCALCALQNHVKT 321 GL+NLGNTC++NS+LQCL+ T+ YL+ + S RTA L + T Sbjct: 20 GLRNLGNTCFMNSILQCLSNTKELRDYCLQNQYLRDLNNNSRMRTALMSEFAKLIQLLWT 79 Query: 322 ALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 + S V+PS+ ++ + F Q+DA E + Sbjct: 80 S--SPNDSVSPSEFKTQIQRYAPRFVGYNQQDAQEFL 114
>UBPX_CAEEL (P34547) Probable ubiquitin carboxyl-terminal hydrolase R10E11.3| (EC 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin-specific processing protease) (Deubiquitinating enzyme) Length = 410 Score = 48.5 bits (114), Expect = 7e-06 Identities = 30/93 (32%), Positives = 45/93 (48%), Gaps = 4/93 (4%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAA----YLQSGRHKSSCRTAGFCALCALQNHVKTAL 327 GL N GNTCY NSV+Q L + PF Y Q+ + + + L L + + + Sbjct: 28 GLVNFGNTCYCNSVIQALFFCRPFREKVLNYKQTLKKSGASKDNLVTCLADLFHSIASQK 87 Query: 328 QSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHE 426 + G I P + + L+ + F N Q+DAHE Sbjct: 88 RRVGTI-APKRFITKLKKENELFDNYMQQDAHE 119
>UBP8_YEAST (P50102) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 471 Score = 48.1 bits (113), Expect = 9e-06 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 14/104 (13%) Frame = +1 Query: 157 AGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSC--RTAGFCALCALQN------- 309 +GL N+G+TC+++S+LQCL + F + S H ++C R+ C CAL Sbjct: 137 SGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELYG 196 Query: 310 --HVKTALQSTGKIVTPSQIVKNLRC---ISRSFRNSRQEDAHE 426 + K A S+ + + L C I+++ Q+DAHE Sbjct: 197 ALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHE 240
>UBP5_ARATH (O22207) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (AtUBP5) Length = 924 Score = 48.1 bits (113), Expect = 9e-06 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHK 261 GL NLGNTC++NS +QCL +T FA+Y Q H+ Sbjct: 318 GLLNLGNTCFMNSAIQCLVHTPEFASYFQEDYHQ 351
>UBP12_SCHPO (O60079) Probable ubiquitin carboxyl-terminal hydrolase 12 (EC| 3.1.2.15) (Ubiquitin thioesterase 12) (Ubiquitin-specific processing protease 12) (Deubiquitinating enzyme 12) Length = 979 Score = 47.8 bits (112), Expect = 1e-05 Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 5/96 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTA-----GFCALCALQNHVKTA 324 GL NLGNTCY+NS LQCLT+T + S K+ + G + +K+ Sbjct: 312 GLSNLGNTCYMNSALQCLTHTRELRDFFTSDEWKNQVNESNPLGMGGQVASIFASLIKSL 371 Query: 325 LQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 P Q + + SF Q+D+ E + Sbjct: 372 YSPEHSSFAPRQFKATIGKFNHSFLGYGQQDSQEFL 407
>UBP33_HUMAN (Q8TEY7) Ubiquitin carboxyl-terminal hydrolase 33 (EC 3.1.2.15)| (Ubiquitin thioesterase 33) (Ubiquitin-specific-processing protease 33) (Deubiquitinating enzyme 33) (VHL-interacting deubiquitinating enzyme 1) Length = 942 Score = 47.8 bits (112), Expect = 1e-05 Identities = 30/94 (31%), Positives = 49/94 (52%), Gaps = 3/94 (3%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAA-YLQSGRHKSSCRTAGFCALCALQNHVKTAL--Q 330 GL+N+GNTCY+N+ LQ L+ P +L G RT A+C + T L + Sbjct: 186 GLKNIGNTCYMNAALQALSNCPPLTQFFLDCG---GLARTDKKPAICKSYLKLMTELWYK 242 Query: 331 STGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 S V P+ + + ++ ++ +FR Q+DA E + Sbjct: 243 SRPGSVVPTTLFQGIKTVNPTFRGYSQQDAQEFL 276
>UBP3_HUMAN (Q9Y6I4) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 521 Score = 47.4 bits (111), Expect = 2e-05 Identities = 31/104 (29%), Positives = 50/104 (48%), Gaps = 15/104 (14%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQ------------SGRHKSSCRTAGFCALCAL 303 GL+NLGNTC++N++LQ L+ E F Y + +GR R+ G + + Sbjct: 160 GLRNLGNTCFMNAILQSLSNIEQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLV 219 Query: 304 QNHVKTAL---QSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHE 426 + KT Q + +P + + I +FR +Q+DAHE Sbjct: 220 EEFRKTLCALWQGSQTAFSPESLFYVVWKIMPNFRGYQQQDAHE 263
>UBP8_MOUSE (Q80U87) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific-processing protease 8) (Deubiquitinating enzyme 8) (mUBPy) Length = 1080 Score = 45.1 bits (105), Expect = 8e-05 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 5/96 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTA---GFCALCALQNHVKTALQ 330 GL+NLGNTCY+NS+LQCL A Y ++ + G A + + Sbjct: 740 GLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKAL 799 Query: 331 STG--KIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 TG + ++P + I+ F S Q+D+ EL+ Sbjct: 800 WTGQYRYISPKDFKVTIGKINDQFAGSSQQDSQELL 835
>UBP21_MOUSE (Q9QZL6) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 566 Score = 44.7 bits (104), Expect = 1e-04 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = +1 Query: 112 DPELTVARIYLGRIGAGLQNLGNTCYLNSVLQCLTYTEP 228 D ++ + LG GL+NLGNTC+LN+VLQCL+ T P Sbjct: 197 DDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRP 235
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 44.7 bits (104), Expect = 1e-04 Identities = 27/96 (28%), Positives = 41/96 (42%), Gaps = 5/96 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALC-----ALQNHVKTA 324 GL NLGNTC++NS LQCL+ T P Y +++ + A +K Sbjct: 303 GLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQM 362 Query: 325 LQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 V PS + + F +Q+D+ EL+ Sbjct: 363 WSGRDAHVAPSMFKTQVGRFAPQFSGYQQQDSQELL 398
>UBP21_HUMAN (Q9UK80) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific-processing protease 21) (Deubiquitinating enzyme 21) (NEDD8-specific protease) Length = 565 Score = 44.7 bits (104), Expect = 1e-04 Identities = 20/39 (51%), Positives = 27/39 (69%) Frame = +1 Query: 112 DPELTVARIYLGRIGAGLQNLGNTCYLNSVLQCLTYTEP 228 D ++ + LG GL+NLGNTC+LN+VLQCL+ T P Sbjct: 197 DDKMAHHTLLLGSGHVGLRNLGNTCFLNAVLQCLSSTRP 235
>UBP7_YEAST (P40453) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) Length = 1071 Score = 44.7 bits (104), Expect = 1e-04 Identities = 19/43 (44%), Positives = 28/43 (65%) Frame = +1 Query: 136 IYLGRIGAGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKS 264 +Y+ GL+NLGNTCY+NS++QCL + F S ++KS Sbjct: 602 VYVSLSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKS 644
>UBP15_MOUSE (Q8R5H1) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 981 Score = 43.9 bits (102), Expect = 2e-04 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 5/96 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCAL-----CALQNHVKTA 324 GL NLGNTC++NS +QCL+ T P Y + +++ + + +K Sbjct: 290 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 349 Query: 325 LQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 VTP + + F +Q+D EL+ Sbjct: 350 WSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELL 385
>UBP15_HUMAN (Q9Y4E8) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) (Unph-2) (Unph4) Length = 981 Score = 43.9 bits (102), Expect = 2e-04 Identities = 25/96 (26%), Positives = 41/96 (42%), Gaps = 5/96 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCAL-----CALQNHVKTA 324 GL NLGNTC++NS +QCL+ T P Y + +++ + + +K Sbjct: 290 GLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQM 349 Query: 325 LQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 VTP + + F +Q+D EL+ Sbjct: 350 WSGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELL 385
>UBP8_SCHPO (Q09738) Probable ubiquitin carboxyl-terminal hydrolase 8 (EC| 3.1.2.15) (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) Length = 449 Score = 43.5 bits (101), Expect = 2e-04 Identities = 25/91 (27%), Positives = 43/91 (47%), Gaps = 2/91 (2%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQSTG 339 G+QNLG TC+++ +LQ + + SG H S+ C CA+ + + S Sbjct: 146 GIQNLGATCFMSVILQSILHNPLVRNLFFSGFHTSTDCKRPTCMTCAIDDMFSSIYNSKN 205 Query: 340 K--IVTPSQIVKNLRCISRSFRNSRQEDAHE 426 K P+ ++ + +S+S Q+D HE Sbjct: 206 KSTFYGPTAVLNLMWKLSKSLCGYSQQDGHE 236
>UBP4_MOUSE (P35123) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein) Length = 962 Score = 43.1 bits (100), Expect = 3e-04 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 5/96 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALC-----ALQNHVKTA 324 GL NLGNTC++NS LQCL+ T P Y +++ + A +K Sbjct: 303 GLGNLGNTCFMNSALQCLSNTAPLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQM 362 Query: 325 LQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 V P + + F +Q+D+ EL+ Sbjct: 363 WSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELL 398
>UBP8_HUMAN (P40818) Ubiquitin carboxyl-terminal hydrolase 8 (EC 3.1.2.15)| (Ubiquitin thioesterase 8) (Ubiquitin-specific processing protease 8) (Deubiquitinating enzyme 8) (hUBPy) Length = 1118 Score = 42.4 bits (98), Expect = 5e-04 Identities = 28/96 (29%), Positives = 44/96 (45%), Gaps = 5/96 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTA---GFCALCALQNHVKTALQ 330 GL+NLGNTCY+NS+LQCL A Y ++ + G A + + Sbjct: 778 GLRNLGNTCYMNSILQCLCNAPHLADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKAL 837 Query: 331 STG--KIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 TG + ++P + I+ F Q+D+ EL+ Sbjct: 838 WTGQYRYISPKDFKITIGKINDQFAGYSQQDSQELL 873
>UBP4_SCHPO (O60139) Probable ubiquitin carboxyl-terminal hydrolase 4 (EC| 3.1.2.15) (Ubiquitin thioesterase 4) (Ubiquitin-specific processing protease 4) (Deubiquitinating enzyme 4) Length = 438 Score = 42.4 bits (98), Expect = 5e-04 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 7/98 (7%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGR-------HKSSCRTAGFCALCALQNHVK 318 GL NLGNTCY+N VLQCL + + GR K+ T G Sbjct: 73 GLTNLGNTCYMNCVLQCLFACKDLTIPMLQGRGLLQNINTKNPLGTGGKITSAFFSLLQS 132 Query: 319 TALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 L + ++P ++ ++ ++R F Q DA E + Sbjct: 133 VLLNHGQRSISPRNFLEIVQSLNRDFSIDGQCDAQEFL 170
>UBP7_SCHPO (Q9P7S5) Probable ubiquitin carboxyl-terminal hydrolase 7 (EC| 3.1.2.15) (Ubiquitin thioesterase 7) (Ubiquitin-specific processing protease 7) (Deubiquitinating enzyme 7) Length = 875 Score = 42.0 bits (97), Expect = 6e-04 Identities = 32/103 (31%), Positives = 45/103 (43%), Gaps = 9/103 (8%) Frame = +1 Query: 151 IGAGLQNLGNTCYLNSVLQCLTYTE-------PFAAYLQSGRHKSSCRTAGFCALCALQN 309 I GL+NLG TC+ NS LQ L E PF S + ++ L A Sbjct: 206 ISPGLKNLGATCFFNSTLQVLCACEALHDVISPFQYSHSSVIVRKLTKSPESSLLSAFIK 265 Query: 310 HVKTALQSTG--KIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 ++T +S G + P+ R + F S Q+DAHEL+ Sbjct: 266 FLETFYKSDGTISVYRPTTFFGEFRRLHPQFSESVQQDAHELL 308
>UBP20_HUMAN (Q9Y2K6) Ubiquitin carboxyl-terminal hydrolase 20 (EC 3.1.2.15)| (Ubiquitin thioesterase 20) (Ubiquitin-specific-processing protease 20) (Deubiquitinating enzyme 20) Length = 913 Score = 42.0 bits (97), Expect = 6e-04 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 3/94 (3%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAA-YLQSGRHKSSCRTAGFCALCALQNHVKTAL--Q 330 G++NLGN+CY+N+ LQ L+ P +L+ G RT ALC + + + + Sbjct: 146 GMKNLGNSCYMNAALQALSNCPPLTQFFLECG---GLVRTDKKPALCKSYQKLVSEVWHK 202 Query: 331 STGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 V P+ + ++ ++ FR Q+D E + Sbjct: 203 KRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFL 236
>UBP11_HUMAN (P51784) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 920 Score = 41.2 bits (95), Expect = 0.001 Identities = 31/97 (31%), Positives = 45/97 (46%), Gaps = 6/97 (6%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLT----YTEPFA--AYLQSGRHKSSCRTAGFCALCALQNHVKT 321 GL NLGNTC++NS LQCL+ TE F YL+ ++ G A A + VK Sbjct: 267 GLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAE-AYADLVKQ 325 Query: 322 ALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 A + + P + + F +Q D+ EL+ Sbjct: 326 AWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELL 362
>UBP1_HUMAN (O94782) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) (hUBP) Length = 785 Score = 41.2 bits (95), Expect = 0.001 Identities = 32/123 (26%), Positives = 57/123 (46%), Gaps = 32/123 (26%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQ-----------------SGRHKSSCR---TA 279 GL NLGNTCYLNS+LQ L + F + ++ + + K +C+ A Sbjct: 82 GLNNLGNTCYLNSILQVLYFCPGFKSGVKHLFNIISRKKEALKDEANQKDKGNCKEDSLA 141 Query: 280 GFCALCALQNHVKTALQ-----------STGKIVT-PSQIVKNLRCISRSFRNSRQEDAH 423 + +C+LQ+ + + Q T ++ T P +++ LR ++ + Q DA Sbjct: 142 SYELICSLQSLIISVEQLQASFLLNPEKYTDELATQPRRLLNTLRELNPMYEGYLQHDAQ 201 Query: 424 ELM 432 E++ Sbjct: 202 EVL 204
>UBP11_MOUSE (Q99K46) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) (Fragment) Length = 797 Score = 40.8 bits (94), Expect = 0.001 Identities = 25/96 (26%), Positives = 40/96 (41%), Gaps = 5/96 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALC-----ALQNHVKTA 324 GL NLGNTC++NS LQCL+ Y + R+ + A + VK Sbjct: 134 GLTNLGNTCFMNSALQCLSNVPQLTEYFLNNRYLEELNFRNPLGMKGELAEAYADLVKQT 193 Query: 325 LQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 + + P+ + + F +Q D+ EL+ Sbjct: 194 WSGYHRSIVPNVFKNKVGHFASQFLGYQQHDSQELL 229
>UBP1_SCHPO (Q9USM5) Probable ubiquitin carboxyl-terminal hydrolase 1 (EC| 3.1.2.15) (Ubiquitin thioesterase 1) (Ubiquitin-specific processing protease 1) (Deubiquitinating enzyme 1) Length = 849 Score = 40.8 bits (94), Expect = 0.001 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHK 261 GL NLGN+CY+NS LQC+ +T Y S ++ Sbjct: 280 GLYNLGNSCYMNSALQCMIHTHELTKYFLSDSYE 313
>UBP49_HUMAN (Q70CQ1) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 688 Score = 39.3 bits (90), Expect = 0.004 Identities = 15/24 (62%), Positives = 21/24 (87%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL+NLGNTCY+NS+LQ L++ + F Sbjct: 254 GLRNLGNTCYMNSILQVLSHLQKF 277
>UBP49_MOUSE (Q6P9L4) Ubiquitin carboxyl-terminal hydrolase 49 (EC 3.1.2.15)| (Ubiquitin thioesterase 49) (Ubiquitin-specific-processing protease 49) (Deubiquitinating enzyme 49) Length = 685 Score = 39.3 bits (90), Expect = 0.004 Identities = 15/24 (62%), Positives = 21/24 (87%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL+NLGNTCY+NS+LQ L++ + F Sbjct: 251 GLRNLGNTCYMNSILQVLSHLQKF 274
>UBP30_HUMAN (Q70CQ3) Ubiquitin carboxyl-terminal hydrolase 30 (EC 3.1.2.15)| (Ubiquitin thioesterase 30) (Ubiquitin-specific-processing protease 30) (Deubiquitinating enzyme 30) Length = 517 Score = 38.9 bits (89), Expect = 0.005 Identities = 30/99 (30%), Positives = 49/99 (49%), Gaps = 9/99 (9%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYL-----QSGRHKSSCRTAGFCALCALQNHVKTA 324 GL NLGNTC++NS+LQ L+ F +L Q R + + + +L L H+ A Sbjct: 69 GLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYSRDQKEPPSHQYLSLTLL--HLLKA 126 Query: 325 LQ----STGKIVTPSQIVKNLRCISRSFRNSRQEDAHEL 429 L + +++ S ++ LR + ++DAHEL Sbjct: 127 LSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHEL 165
>UBP12_YEAST (P39538) Ubiquitin carboxyl-terminal hydrolase 12 (EC 3.1.2.15)| (Ubiquitin thioesterase 12) (Ubiquitin-specific-processing protease 12) (Deubiquitinating enzyme 12) Length = 1254 Score = 38.5 bits (88), Expect = 0.007 Identities = 16/27 (59%), Positives = 18/27 (66%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAY 240 GL NLGNTCY+NS LQCL + Y Sbjct: 365 GLVNLGNTCYMNSALQCLVHIPQLRDY 391
>UBP9_SCHPO (Q9P7V9) Probable ubiquitin carboxyl-terminal hydrolase 9 (EC| 3.1.2.15) (Ubiquitin thioesterase 9) (Ubiquitin-specific processing protease 9) (Deubiquitinating enzyme 9) Length = 585 Score = 38.5 bits (88), Expect = 0.007 Identities = 24/70 (34%), Positives = 34/70 (48%) Frame = +1 Query: 115 PELTVARIYLGRIGAGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCAL 294 PE R Y GL N GNTCY++SVL L + +PF L S + F ++ Sbjct: 33 PETLTDRFY------GLTNYGNTCYVSSVLVSLYHLKPFRDSLNS--YPLPSAPPNFKSV 84 Query: 295 CALQNHVKTA 324 C NH +++ Sbjct: 85 CTKTNHPESS 94 Score = 28.5 bits (62), Expect = 7.4 Identities = 11/28 (39%), Positives = 21/28 (75%) Frame = +1 Query: 343 IVTPSQIVKNLRCISRSFRNSRQEDAHE 426 I +P + ++ LR + +FR+++Q+DAHE Sbjct: 174 ICSPERFIQVLRRDNEAFRSTQQQDAHE 201
>UBP26_HUMAN (Q9BXU7) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 913 Score = 38.1 bits (87), Expect = 0.009 Identities = 29/99 (29%), Positives = 42/99 (42%), Gaps = 4/99 (4%) Frame = +1 Query: 148 RIGAGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTAL 327 +I GL NLGNTCY+N+VLQ L FA L + +C + Sbjct: 292 KICHGLPNLGNTCYMNAVLQSLLSIPSFADDLLNQSFPWGKIPLNALTMCLAR---LLFF 348 Query: 328 QSTGKIVTPSQIVKNLR----CISRSFRNSRQEDAHELM 432 + T I ++ NL+ + F + Q DAHE + Sbjct: 349 KDTYNIEIKEMLLLNLKKAISAAAEIFHGNAQNDAHEFL 387
>UBP44_HUMAN (Q9H0E7) Ubiquitin carboxyl-terminal hydrolase 44 (EC 3.1.2.15)| (Ubiquitin thioesterase 44) (Ubiquitin-specific-processing protease 44) (Deubiquitinating enzyme 44) Length = 712 Score = 37.4 bits (85), Expect = 0.016 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTY 219 GL+NLGNTCY+NSVLQ L++ Sbjct: 274 GLRNLGNTCYMNSVLQVLSH 293
>UBP1_ARATH (Q9FPT5) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) (AtUBP1) Length = 1083 Score = 37.4 bits (85), Expect = 0.016 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 1/92 (1%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAA-YLQSGRHKSSCRTAGFCALCALQNHVKTALQST 336 GL NLGNTC+ NSV+Q L + +L+ S + L A N + ++ Sbjct: 203 GLVNLGNTCFFNSVMQNLLSLDQLREHFLKEDLSVSGPLVSSLKELFAESNSEASVFRNE 262 Query: 337 GKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 + P + ++ + FR +Q D+HEL+ Sbjct: 263 ---INPRDLFFSVCSQAPQFRGYQQHDSHELL 291
>UBP4_YEAST (P32571) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Vacuole biogenesis protein SSV7) Length = 926 Score = 36.6 bits (83), Expect = 0.027 Identities = 29/99 (29%), Positives = 46/99 (46%), Gaps = 10/99 (10%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFA------AYLQSGRHKSSCRTAGFCA-LCALQNHVK 318 GL+NLGN+CY+N ++QC+ T +Y + S + G A A H+ Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHININSKLGSKGILAKYFARLVHMM 622 Query: 319 TALQSTG-KIVTPSQIVKNLRC--ISRSFRNSRQEDAHE 426 Q G K ++ S I L C ++ F+ + Q+D E Sbjct: 623 YKEQVDGSKKISISPIKFKLACGSVNSLFKTASQQDCQE 661
>UBP14_CAEEL (Q17361) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 489 Score = 36.6 bits (83), Expect = 0.027 Identities = 30/99 (30%), Positives = 43/99 (43%), Gaps = 8/99 (8%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF----AAYLQSGRHKSS-CRTAGFCALCALQNHVK-- 318 GL NLGNTCY NS +Q L A ++ H C L L N ++ Sbjct: 103 GLANLGNTCYFNSCVQMLKEVNELVLKPAEEMRIREHNDRLCHN-----LATLFNSLRDK 157 Query: 319 -TALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 AL+S G+ + P + L F +Q+DA+E + Sbjct: 158 DRALRSKGEPIKPFAAILTLSDSFPQFEKFKQQDANECL 196
>UBP11_YEAST (P36026) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 717 Score = 36.2 bits (82), Expect = 0.035 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 4/74 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHV----KTAL 327 GLQN NTCY+NS++QCL T F + +++ T + L + K Sbjct: 299 GLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNTNKYPKEVQLSRSIYVLFKKMY 358 Query: 328 QSTGKIVTPSQIVK 369 + G+ + P++ +K Sbjct: 359 LNGGRAIIPNRFLK 372
>UBPL_MIMIV (Q5UQR3) Probable ubiquitin carboxyl-terminal hydrolase (EC| 3.1.2.15) (Ubiquitin thioesterase) (Ubiquitin specific-processing protease) (Deubiquitinating enzyme) Length = 468 Score = 36.2 bits (82), Expect = 0.035 Identities = 15/28 (53%), Positives = 19/28 (67%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYL 243 G+ NLGNTCY+NS LQ L++ YL Sbjct: 43 GIMNLGNTCYMNSALQALSHNYLLINYL 70
>UBP29_HUMAN (Q9HBJ7) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 922 Score = 36.2 bits (82), Expect = 0.035 Identities = 32/116 (27%), Positives = 48/116 (41%), Gaps = 9/116 (7%) Frame = +1 Query: 112 DPELTVARIYLG----RIGAGLQNLGNTCYLNSVLQCLTYTEPFAAYLQS-----GRHKS 264 DP A++ L ++ G NLGNTCY+N+VLQ L FA L + Sbjct: 266 DPRCNKAQVPLDSHSQQLQQGFPNLGNTCYMNAVLQSLFAIPSFADDLLTQGVPWEYIPF 325 Query: 265 SCRTAGFCALCALQNHVKTALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 L AL++ T + K + K + ++ F + Q DAHE + Sbjct: 326 EALIMTLTQLLALKDFCSTKI----KRELLGNVKKVISAVAEIFSGNMQNDAHEFL 377
>UBP9_YEAST (P39967) Ubiquitin carboxyl-terminal hydrolase 9 (EC 3.1.2.15)| (Ubiquitin thioesterase 9) (Ubiquitin-specific-processing protease 9) (Deubiquitinating enzyme 9) Length = 754 Score = 35.8 bits (81), Expect = 0.046 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 G +N GNTCY NSVLQCL Sbjct: 135 GYENFGNTCYCNSVLQCL 152
>UBP13_YEAST (P38187) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) Length = 688 Score = 35.8 bits (81), Expect = 0.046 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 G +N GNTCY NSVLQCL Sbjct: 141 GYENFGNTCYCNSVLQCL 158
>UBP5_YEAST (P39944) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) Length = 805 Score = 35.8 bits (81), Expect = 0.046 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYT 222 GL+N+GN CY+N +LQCL T Sbjct: 447 GLENIGNCCYMNCILQCLVGT 467
>UBP19_HUMAN (O94966) Ubiquitin carboxyl-terminal hydrolase 19 (EC 3.1.2.15)| (Ubiquitin thioesterase 19) (Ubiquitin-specific-processing protease 19) (Deubiquitinating enzyme 19) (Zinc finger MYND domain-containing protein 9) (Fragment) Length = 1371 Score = 35.8 bits (81), Expect = 0.046 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 6/97 (6%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSG------RHKSSCRTAGFCALCALQNHVKT 321 GL NLGNTC++NSV+Q L+ T + + + T G A+ ++ Sbjct: 551 GLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPLGTGGRLAI-GFAVLLRA 609 Query: 322 ALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 + T PS++ + + F Q DA E M Sbjct: 610 LWKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFM 646
>UBP35_HUMAN (Q9P2H5) Ubiquitin carboxyl-terminal hydrolase 35 (EC 3.1.2.15)| (Ubiquitin thioesterase 35) (Ubiquitin-specific-processing protease 35) (Deubiquitinating enzyme 35) Length = 1017 Score = 35.8 bits (81), Expect = 0.046 Identities = 21/42 (50%), Positives = 26/42 (61%) Frame = +1 Query: 106 GLDPELTVARIYLGRIGAGLQNLGNTCYLNSVLQCLTYTEPF 231 G P L +A+ G+IG L NLGNTCY+NS+LQ L F Sbjct: 426 GFYPRL-MAKSDTGKIG--LINLGNTCYVNSILQALFMASEF 464
>UBP38_MOUSE (Q8BW70) Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.1.2.15)| (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38) (Deubiquitinating enzyme 38) Length = 1042 Score = 35.4 bits (80), Expect = 0.061 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL NLGNTCY+NSVLQ L F Sbjct: 446 GLINLGNTCYMNSVLQALFMATEF 469
>UBP14_YEAST (P38237) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (Glucose-induced degradation protein 6) Length = 803 Score = 35.4 bits (80), Expect = 0.061 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +1 Query: 154 GAGLQNLGNTCYLNSVLQCL 213 G GL NLGN+CYLNSV+Q L Sbjct: 344 GCGLINLGNSCYLNSVIQSL 363
>UBP29_MOUSE (Q9ES63) Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.1.2.15)| (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29) (Deubiquitinating enzyme 29) Length = 869 Score = 35.4 bits (80), Expect = 0.061 Identities = 26/96 (27%), Positives = 46/96 (47%), Gaps = 5/96 (5%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQS-----GRHKSSCRTAGFCALCALQNHVKTA 324 G NLGNTCY+NS+LQ + FA L + + L L++ Sbjct: 290 GFPNLGNTCYMNSILQSVFGIPTFAKDLLTQGIPWEKVSYDDLIMPLSQLLVLKDIRDVE 349 Query: 325 LQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 ++ G+++T + K++ ++ +F + Q DAHE + Sbjct: 350 IK--GELLT--SVKKSISTVADTFSGNEQNDAHEFL 381
>UBP2_KLULA (O42726) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) Length = 1220 Score = 35.4 bits (80), Expect = 0.061 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 11/53 (20%) Frame = +1 Query: 157 AGLQNLGNTCYLNSVLQ-----------CLTYTEPFAAYLQSGRHKSSCRTAG 282 AG+ N+GNTCYLNS+LQ L Y + A L + + S R G Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFILNYDDDSAKLLDASEYHSRRRIGG 750
>UBP40_HUMAN (Q9NVE5) Ubiquitin carboxyl-terminal hydrolase 40 (EC 3.1.2.15)| (Ubiquitin thioesterase 40) (Ubiquitin-specific-processing protease 40) (Deubiquitinating enzyme 40) Length = 1235 Score = 35.0 bits (79), Expect = 0.079 Identities = 16/31 (51%), Positives = 21/31 (67%) Frame = +1 Query: 157 AGLQNLGNTCYLNSVLQCLTYTEPFAAYLQS 249 +G++N G TCYLNS+LQ L +T F L S Sbjct: 41 SGIRNQGGTCYLNSLLQTLHFTPEFREALFS 71
>UBP37_HUMAN (Q86T82) Ubiquitin carboxyl-terminal hydrolase 37 (EC 3.1.2.15)| (Ubiquitin thioesterase 37) (Ubiquitin-specific-processing protease 37) (Deubiquitinating enzyme 37) Length = 979 Score = 35.0 bits (79), Expect = 0.079 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFA 234 G NLGNTCY+N++LQ L + FA Sbjct: 342 GFSNLGNTCYMNAILQSLFSLQSFA 366
>UBP14_HUMAN (P54578) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 493 Score = 35.0 bits (79), Expect = 0.079 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 8/97 (8%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQ--SGRHKSSCRTAGFCALCALQNHVKTALQS 333 GL NLGNTCY+N+ +QC+ L+ +G ++S A + A + ++ Sbjct: 105 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 164 Query: 334 TGKIVTPSQIVKNLRCISRSFRNS------RQEDAHE 426 T + P +++ L F Q+DA+E Sbjct: 165 TSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANE 201
>UBP14_RABIT (P40826) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 35.0 bits (79), Expect = 0.079 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 8/97 (8%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQ--SGRHKSSCRTAGFCALCALQNHVKTALQS 333 GL NLGNTCY+N+ +QC+ L+ +G ++S A + A + ++ Sbjct: 105 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 164 Query: 334 TGKIVTPSQIVKNLRCISRSFRNS------RQEDAHE 426 T + P +++ L F Q+DA+E Sbjct: 165 TSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANE 201
>UBP14_PANTR (P60051) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 35.0 bits (79), Expect = 0.079 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 8/97 (8%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQ--SGRHKSSCRTAGFCALCALQNHVKTALQS 333 GL NLGNTCY+N+ +QC+ L+ +G ++S A + A + ++ Sbjct: 105 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 164 Query: 334 TGKIVTPSQIVKNLRCISRSFRNS------RQEDAHE 426 T + P +++ L F Q+DA+E Sbjct: 165 TSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANE 201
>UBP14_MOUSE (Q9JMA1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) Length = 492 Score = 35.0 bits (79), Expect = 0.079 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 8/97 (8%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQ--SGRHKSSCRTAGFCALCALQNHVKTALQS 333 GL NLGNTCY+N+ +QC+ L+ +G ++S A + A + ++ Sbjct: 105 GLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDK 164 Query: 334 TGKIVTPSQIVKNLRCISRSFRNS------RQEDAHE 426 T + P +++ L F Q+DA+E Sbjct: 165 TSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANE 201
>UBP38_HUMAN (Q8NB14) Ubiquitin carboxyl-terminal hydrolase 38 (EC 3.1.2.15)| (Ubiquitin thioesterase 38) (Ubiquitin-specific-processing protease 38) (Deubiquitinating enzyme 38) (HP43.8KD) Length = 1042 Score = 34.7 bits (78), Expect = 0.10 Identities = 15/24 (62%), Positives = 17/24 (70%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL NLGNTCY+NSV+Q L F Sbjct: 446 GLINLGNTCYMNSVIQALFMATDF 469
>UBP14_SCHPO (Q11119) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (UBA-domain-containing protein 2) Length = 775 Score = 34.7 bits (78), Expect = 0.10 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQS--GRHKSSCRTAGFCALCALQNHVKTALQS 333 GL+NLGN+CYL S +Q L + FA + + + S C+T C L + Sbjct: 301 GLKNLGNSCYLASTMQSLFSIKEFAIHELNLFNTYNSVCQTPTTDLQCQLGKLADGLV-- 358 Query: 334 TGKIVTPSQI 363 +GK PS+I Sbjct: 359 SGKFSKPSKI 368
>UBP6_SCHPO (Q92353) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thiolesterase 6) (Ubiquitin-specific processing protease 6) (Deubiquitinating enzyme 6) Length = 467 Score = 34.7 bits (78), Expect = 0.10 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 7/97 (7%) Frame = +1 Query: 157 AGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQST 336 +GL NLGNTCY+NS +Q L A + S ++G L A + ++QS Sbjct: 100 SGLINLGNTCYMNSTVQML------RAIPELSDAVSQFNSSG--GLVAEYRTLLNSMQSN 151 Query: 337 GKIVTPSQIVKNLRC-------ISRSFRNSRQEDAHE 426 VTP + +++LR +SR Q+DA E Sbjct: 152 AP-VTPMRFLQSLRMEYPQFAEMSRETGGYAQQDAEE 187
>UBP2_YEAST (Q01476) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) Length = 1272 Score = 34.3 bits (77), Expect = 0.13 Identities = 14/28 (50%), Positives = 18/28 (64%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYL 243 G+ N+GNTCYLNS+LQ P Y+ Sbjct: 737 GINNIGNTCYLNSLLQYYFSIAPLRRYV 764
>UBP2_ARATH (Q8W4N3) Ubiquitin carboxyl-terminal hydrolase 2 (EC 3.1.2.15)| (Ubiquitin thioesterase 2) (Ubiquitin-specific-processing protease 2) (Deubiquitinating enzyme 2) (AtUBP2) Length = 961 Score = 33.9 bits (76), Expect = 0.18 Identities = 25/97 (25%), Positives = 43/97 (44%), Gaps = 1/97 (1%) Frame = +1 Query: 145 GRIGAGLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTA 324 G + GL NLGNTC+ NS++Q L + + ++ G A + +T Sbjct: 227 GYVVRGLVNLGNTCFFNSIMQNLLSLDRLRDHFLK---ENGSGVGGPLASSLRKLFTETK 283 Query: 325 LQSTGK-IVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 ++ K ++ P + + FR Q D+HEL+ Sbjct: 284 PEAGLKSVINPRAFFGSFCSKAPQFRGYDQHDSHELL 320
>UBP26_MOUSE (Q99MX1) Ubiquitin carboxyl-terminal hydrolase 26 (EC 3.1.2.15)| (Ubiquitin thioesterase 26) (Ubiquitin-specific-processing protease 26) (Deubiquitinating enzyme 26) Length = 835 Score = 33.9 bits (76), Expect = 0.18 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +1 Query: 136 IYLGRIGAGLQNLGNTCYLNSVLQCL 213 +Y ++ GL N+GNTCY+N VLQ L Sbjct: 279 LYPEKLWQGLPNVGNTCYINVVLQSL 304
>UBP5_MOUSE (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 33.5 bits (75), Expect = 0.23 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 G++NLGN+CYLNSV+Q L Sbjct: 327 GIRNLGNSCYLNSVVQVL 344
>UBP5_HUMAN (P45974) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 33.5 bits (75), Expect = 0.23 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 G++NLGN+CYLNSV+Q L Sbjct: 327 GIRNLGNSCYLNSVVQVL 344
>UBP6_YEAST (P43593) Ubiquitin carboxyl-terminal hydrolase 6 (EC 3.1.2.15)| (Ubiquitin thioesterase 6) (Ubiquitin-specific-processing protease 6) (Deubiquitinating enzyme 6) Length = 499 Score = 33.5 bits (75), Expect = 0.23 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = +1 Query: 109 LDPELTVARIYLGRIGAGLQNLGNTCYLNSVLQCL 213 L PE V + ++ G +N+GNTCYLN+ LQ L Sbjct: 95 LAPEQQVQQF--AQLPVGFKNMGNTCYLNATLQAL 127
>UBP3_SCHPO (O94269) Probable ubiquitin carboxyl-terminal hydrolase 3 (EC| 3.1.2.15) (Ubiquitin thioesterase 3) (Ubiquitin-specific processing protease 3) (Deubiquitinating enzyme 3) Length = 512 Score = 33.5 bits (75), Expect = 0.23 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 G N GN C++NS+LQ L Y PF Sbjct: 134 GFINTGNICFMNSILQALMYCVPF 157
>UBP1_YEAST (P25037) Ubiquitin carboxyl-terminal hydrolase 1 (EC 3.1.2.15)| (Ubiquitin thioesterase 1) (Ubiquitin-specific-processing protease 1) (Deubiquitinating enzyme 1) Length = 809 Score = 33.5 bits (75), Expect = 0.23 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = +1 Query: 157 AGLQNLGNTCYLNSVLQCLTYTEPFAAYLQS 249 AGL N GNTC++NSVLQ L + +L + Sbjct: 101 AGLVNDGNTCFMNSVLQSLASSRELMEFLDN 131
>UBP16_HUMAN (Q9Y5T5) Ubiquitin carboxyl-terminal hydrolase 16 (EC 3.1.2.15)| (Ubiquitin thioesterase 16) (Ubiquitin-specific-processing protease 16) (Deubiquitinating enzyme 16) (Ubiquitin-processing protease UBP-M) Length = 823 Score = 33.1 bits (74), Expect = 0.30 Identities = 25/109 (22%), Positives = 46/109 (42%), Gaps = 18/109 (16%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKS------------------SCRTAGF 285 GL NLGNTC+ N+V+Q L+ T L+ + + G Sbjct: 197 GLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDLALTEPLEINLEPPGP 256 Query: 286 CALCALQNHVKTALQSTGKIVTPSQIVKNLRCISRSFRNSRQEDAHELM 432 L A+ + ++ +VTP ++ + + F+ +Q+D+ EL+ Sbjct: 257 LTL-AMSQFLNEMQETKKGVVTPKELFSQVCKKAVRFKGYQQQDSQELL 304
>UBP28_CHICK (Q5ZID5) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1047 Score = 33.1 bits (74), Expect = 0.30 Identities = 29/102 (28%), Positives = 45/102 (44%), Gaps = 11/102 (10%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF----AAYLQSGRHKSSCRT----AGFCALCALQNHV 315 G++N+GNTC+ ++V+Q L F +Y SCRT + LQ Sbjct: 157 GMKNIGNTCWFSAVIQSLFQLPQFRRLVLSYSFPPNVLESCRTRTGKRNIAFMQELQCLF 216 Query: 316 KTALQSTGKIVTPSQIVKNLRCISRSFRNSRQ---EDAHELM 432 L + K V PS ++ LR +S +Q E H+L+ Sbjct: 217 ALMLGTRRKFVDPSAALELLRDAFKSTEEQQQDVSEFTHKLL 258
>UBP40_MOUSE (Q8BWR4) Ubiquitin carboxyl-terminal hydrolase 40 (EC 3.1.2.15)| (Ubiquitin thioesterase 40) (Ubiquitin-specific-processing protease 40) (Deubiquitinating enzyme 40) (Fragment) Length = 1140 Score = 33.1 bits (74), Expect = 0.30 Identities = 15/31 (48%), Positives = 21/31 (67%) Frame = +1 Query: 157 AGLQNLGNTCYLNSVLQCLTYTEPFAAYLQS 249 +G++N G TCYL+S+LQ L +T F L S Sbjct: 41 SGIRNQGGTCYLSSLLQTLHFTPEFREALFS 71
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 33.1 bits (74), Expect = 0.30 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL+N G TCY+NS+LQ L +T F Sbjct: 231 GLKNQGATCYMNSLLQSLFFTNIF 254
>UBP7_HUMAN (Q93009) Ubiquitin carboxyl-terminal hydrolase 7 (EC 3.1.2.15)| (Ubiquitin thioesterase 7) (Ubiquitin-specific-processing protease 7) (Deubiquitinating enzyme 7) (Herpesvirus-associated ubiquitin-specific protease) Length = 1102 Score = 32.3 bits (72), Expect = 0.51 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF--AAYLQSGRHKSSCRTAGFCALCALQNHVKTALQS 333 GL+N G TCY+NS+LQ L +T A Y+ S ++ ALQ V LQ Sbjct: 215 GLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPL----ALQ-RVFYELQH 269 Query: 334 TGKIVTPSQIVKN 372 + K V ++ K+ Sbjct: 270 SDKPVGTKKLTKS 282
>UBP13_HUMAN (Q92995) Ubiquitin carboxyl-terminal hydrolase 13 (EC 3.1.2.15)| (Ubiquitin thioesterase 13) (Ubiquitin-specific-processing protease 13) (Deubiquitinating enzyme 13) (Isopeptidase T-3) (ISOT-3) Length = 863 Score = 32.3 bits (72), Expect = 0.51 Identities = 12/18 (66%), Positives = 17/18 (94%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 GL+NLGN+CYL+SV+Q + Sbjct: 337 GLKNLGNSCYLSSVMQAI 354
>UBPA_DICDI (P54201) Ubiquitin carboxyl-terminal hydrolase A (EC 3.1.2.15)| (Ubiquitin thioesterase A) (Ubiquitin-specific-processing protease A) (Deubiquitinating enzyme A) Length = 837 Score = 32.0 bits (71), Expect = 0.67 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQSGRHKS 264 G++NLGN+CY++SV+Q + + F R S Sbjct: 320 GIENLGNSCYMSSVIQMIFAIDSFQTRYLKDREAS 354
>UBP28_MOUSE (Q5I043) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1051 Score = 31.6 bits (70), Expect = 0.87 Identities = 29/102 (28%), Positives = 44/102 (43%), Gaps = 11/102 (10%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF----AAYLQSGRHKSSCRT----AGFCALCALQNHV 315 GL+N+GNTC+ ++V+Q L F +Y +CR+ + LQ Sbjct: 163 GLKNVGNTCWFSAVIQSLFQLPEFRRLVLSYNLPQNILENCRSHTEKRNIMFMQELQYLF 222 Query: 316 KTALQSTGKIVTPSQIVKNLRCISRSFRNSRQ---EDAHELM 432 L S K V PS + L+ RS +Q E H+L+ Sbjct: 223 ALLLGSNRKFVDPSAALDLLKGAFRSSEEQQQDVSEFTHKLL 264
>UBP11_SCHPO (Q9UUD6) Ubiquitin carboxyl-terminal hydrolase 11 (EC 3.1.2.15)| (Ubiquitin thioesterase 11) (Ubiquitin-specific-processing protease 11) (Deubiquitinating enzyme 11) Length = 350 Score = 31.2 bits (69), Expect = 1.1 Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 2/93 (2%) Frame = +1 Query: 160 GLQNL-GNTCYLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQST 336 GL N+ GN C+LN VLQ L E L K C ++ A L ++ Sbjct: 50 GLYNVSGNDCFLNCVLQSLASQESLLEIL-----KLRCSSSTLYA--TLYELLQKLNSGP 102 Query: 337 GKIVTPSQIVKNLR-CISRSFRNSRQEDAHELM 432 G +TP + +L ++ S Q+DA E + Sbjct: 103 GNPITPGSFLNSLEIATNKKLVRSIQQDAQEFL 135
>FAF_DROME (P55824) Probable ubiquitin carboxyl-terminal hydrolase FAF (EC| 3.1.2.15) (Ubiquitin thioesterase FAF) (Ubiquitin specific-processing protease FAF) (Deubiquitinating enzyme FAF) (Protein fat facets) Length = 2778 Score = 31.2 bits (69), Expect = 1.1 Identities = 17/32 (53%), Positives = 20/32 (62%), Gaps = 7/32 (21%) Frame = +1 Query: 139 YLGRIGA-------GLQNLGNTCYLNSVLQCL 213 YL +GA GL+N G TCY+NSVLQ L Sbjct: 1655 YLPPVGARPTKGFCGLKNAGATCYMNSVLQQL 1686
>UBP3_YEAST (Q01477) Ubiquitin carboxyl-terminal hydrolase 3 (EC 3.1.2.15)| (Ubiquitin thioesterase 3) (Ubiquitin-specific-processing protease 3) (Deubiquitinating enzyme 3) Length = 912 Score = 31.2 bits (69), Expect = 1.1 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 151 IGAGLQNLGNTCYLNSVLQCLTYTEPF 231 I G+ N N C+++SVLQ L Y +PF Sbjct: 458 IPRGIINRANICFMSSVLQVLLYCKPF 484
>UBP28_HUMAN (Q96RU2) Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.1.2.15)| (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28) (Deubiquitinating enzyme 28) Length = 1077 Score = 31.2 bits (69), Expect = 1.1 Identities = 28/102 (27%), Positives = 44/102 (43%), Gaps = 11/102 (10%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF----AAYLQSGRHKSSCRT----AGFCALCALQNHV 315 GL+N+GNTC+ ++V+Q L F +Y +CR+ + LQ Sbjct: 163 GLKNVGNTCWFSAVIQSLFQLPEFRRLVLSYSLPQNVLENCRSHTEKRNIMFMQELQYLF 222 Query: 316 KTALQSTGKIVTPSQIVKNLRCISRSFRNSRQ---EDAHELM 432 + S K V PS + L+ RS +Q E H+L+ Sbjct: 223 ALMMGSNRKFVDPSAALDLLKGAFRSSEEQQQDVSEFTHKLL 264
>UBP15_YEAST (P50101) Ubiquitin carboxyl-terminal hydrolase 15 (EC 3.1.2.15)| (Ubiquitin thioesterase 15) (Ubiquitin-specific-processing protease 15) (Deubiquitinating enzyme 15) Length = 1230 Score = 30.8 bits (68), Expect = 1.5 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 G +N G TCYLNS+LQ +T+ F Sbjct: 206 GFRNQGATCYLNSLLQSYFFTKYF 229
>UBP2_SCHPO (Q9P3U0) Probable ubiquitin carboxyl-terminal hydrolase 2 (EC| 3.1.2.15) (Ubiquitin thioesterase 2) (Ubiquitin-specific processing protease 2) (Deubiquitinating enzyme 2) Length = 1141 Score = 30.4 bits (67), Expect = 1.9 Identities = 12/23 (52%), Positives = 16/23 (69%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEP 228 GL+N GN CYLNS++Q +P Sbjct: 615 GLENTGNLCYLNSLIQYYFIIKP 637
>ZN295_HUMAN (Q9ULJ3) Zinc finger protein 295 (Zinc finger and BTB| domain-containing protein 21) Length = 1066 Score = 30.4 bits (67), Expect = 1.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +1 Query: 199 VLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQ 306 V QC ++ L+ G H+ CR A C C+L+ Sbjct: 721 VYQCRLCNAKLSSLLEQGSHERLCRNAAVCPYCSLR 756
>UBP5_SCHPO (Q09879) Probable ubiquitin carboxyl-terminal hydrolase 5 (EC| 3.1.2.15) (Ubiquitin thioesterase 5) (Ubiquitin-specific processing protease 5) (Deubiquitinating enzyme 5) Length = 1108 Score = 30.0 bits (66), Expect = 2.5 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL+N G TCY+NS+LQ L F Sbjct: 214 GLKNQGATCYMNSLLQSLYIIHAF 237
>USP9X_MOUSE (P70398) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin-specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein-related, X-linked) (Ubiquitin-specif Length = 2559 Score = 29.6 bits (65), Expect = 3.3 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 GL+N G TCY+NSV+Q L Sbjct: 1558 GLKNAGATCYMNSVIQQL 1575
>UBPE_DROME (Q24574) Ubiquitin carboxyl-terminal hydrolase 64E (EC 3.1.2.15)| (Ubiquitin thioesterase 64E) (Ubiquitin-specific-processing protease 64E) (Deubiquitinating enzyme 64E) Length = 1556 Score = 29.6 bits (65), Expect = 3.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL N TCYLNS+LQ L T F Sbjct: 397 GLVNQAMTCYLNSLLQALFMTPEF 420
>USP9Y_HUMAN (O00507) Probable ubiquitin carboxyl-terminal hydrolase FAF-Y (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-Y) (Ubiquitin-specific-processing protease FAF-Y) (Deubiquitinating enzyme FAF-Y) (Fat facets protein-related, Y-linked) (Ubiquitin-specif Length = 2555 Score = 29.6 bits (65), Expect = 3.3 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 GL+N G TCY+NSV+Q L Sbjct: 1560 GLKNAGATCYMNSVIQQL 1577
>USP9X_HUMAN (Q93008) Probable ubiquitin carboxyl-terminal hydrolase FAF-X (EC| 3.1.2.15) (Ubiquitin thioesterase FAF-X) (Ubiquitin specific-processing protease FAF-X) (Deubiquitinating enzyme FAF-X) (Fat facets protein related, X-linked) (Ubiquitin-specif Length = 2547 Score = 29.6 bits (65), Expect = 3.3 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 GL+N G TCY+NSV+Q L Sbjct: 1551 GLKNAGATCYMNSVIQQL 1568
>UBP24_HUMAN (Q9UPU5) Ubiquitin carboxyl-terminal hydrolase 24 (EC 3.1.2.15)| (Ubiquitin thioesterase 24) (Ubiquitin-specific-processing protease 24) (Deubiquitinating enzyme 24) Length = 1870 Score = 29.3 bits (64), Expect = 4.3 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 7/46 (15%) Frame = +1 Query: 112 DPELTVARIYLGRIGA-------GLQNLGNTCYLNSVLQCLTYTEP 228 DP LT YL + + GL+N G TCY+N+V Q L Y +P Sbjct: 917 DPALTKEFDYLPPVDSRSSSGFVGLRNGGATCYMNAVFQQL-YMQP 961
>UBP47_HUMAN (Q96K76) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1375 Score = 29.3 bits (64), Expect = 4.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL N TCYLNS+LQ L T F Sbjct: 189 GLVNQAMTCYLNSLLQTLFMTPEF 212
>UBP47_MOUSE (Q8BY87) Ubiquitin carboxyl-terminal hydrolase 47 (EC 3.1.2.15)| (Ubiquitin thioesterase 47) (Ubiquitin-specific-processing protease 47) (Deubiquitinating enzyme 47) Length = 1376 Score = 29.3 bits (64), Expect = 4.3 Identities = 14/24 (58%), Positives = 15/24 (62%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL N TCYLNS+LQ L T F Sbjct: 189 GLVNQAMTCYLNSLLQTLFMTPEF 212
>UBP14_ARATH (Q8L6Y1) Ubiquitin carboxyl-terminal hydrolase 14 (EC 3.1.2.15)| (Ubiquitin thioesterase 14) (Ubiquitin-specific-processing protease 14) (Deubiquitinating enzyme 14) (AtUBP14) (TITAN-6 protein) Length = 797 Score = 28.9 bits (63), Expect = 5.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPF 231 GL NLGN+CYL + +Q + T F Sbjct: 309 GLVNLGNSCYLAATMQIVFSTHSF 332
>UBP10_YEAST (P53874) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) (Disrupter of telomere silencing protein 4) Length = 792 Score = 28.9 bits (63), Expect = 5.7 Identities = 26/109 (23%), Positives = 40/109 (36%), Gaps = 20/109 (18%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQS---GRHKSSCRTAGFCALCALQNHVKTALQ 330 GL N G TCY N+ +Q + + YL G++ S+ +N V L Sbjct: 363 GLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILMGKYDSTIS----------KNSVSYTLA 412 Query: 331 STGK-----------------IVTPSQIVKNLRCISRSFRNSRQEDAHE 426 T K + P ++ L I+ +QED+HE Sbjct: 413 ETSKKMWLPVSKNPRKNVSASYINPKHLISRLDDINCMMSEWQQEDSHE 461
>UBP25_HUMAN (Q9UHP3) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (USP on chromosome 21) Length = 1087 Score = 28.5 bits (62), Expect = 7.4 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 GL+N+GNTC+ ++V+Q L Sbjct: 170 GLKNVGNTCWFSAVIQSL 187
>UBP18_HUMAN (Q9UMW8) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) (hUBP43) Length = 372 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQ 246 GL N+G TC LNS++Q F L+ Sbjct: 56 GLHNIGQTCCLNSLIQVFVMNVDFTRILK 84
>UBP10_MOUSE (P52479) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 792 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEP 228 GL N GN CY+N+ LQ L P Sbjct: 410 GLINKGNWCYINATLQALVACPP 432
>UBP10_HUMAN (Q14694) Ubiquitin carboxyl-terminal hydrolase 10 (EC 3.1.2.15)| (Ubiquitin thioesterase 10) (Ubiquitin-specific-processing protease 10) (Deubiquitinating enzyme 10) Length = 798 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEP 228 GL N GN CY+N+ LQ L P Sbjct: 416 GLINKGNWCYINATLQALVACPP 438
>UBP18_MOUSE (Q9WTV6) Ubl carboxyl-terminal hydrolase 18 (EC 3.1.2.-) (Ubl| thioesterase 18) (ISG15-specific-processing protease) (43 kDa ISG15-specific protease) Length = 368 Score = 28.5 bits (62), Expect = 7.4 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCLTYTEPFAAYLQ 246 GL N+G TC LNS+LQ F L+ Sbjct: 53 GLHNIGQTCCLNSLLQVFMMNMDFRMILK 81
>UBP25_MOUSE (P57080) Ubiquitin carboxyl-terminal hydrolase 25 (EC 3.1.2.15)| (Ubiquitin thioesterase 25) (Ubiquitin-specific-processing protease 25) (Deubiquitinating enzyme 25) (mUSP25) Length = 1055 Score = 28.5 bits (62), Expect = 7.4 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +1 Query: 160 GLQNLGNTCYLNSVLQCL 213 GL+N+GNTC+ ++V+Q L Sbjct: 170 GLKNVGNTCWFSAVIQSL 187
>Y572_TREPA (O83582) Hypothetical protein TP0572| Length = 360 Score = 28.1 bits (61), Expect = 9.7 Identities = 18/64 (28%), Positives = 30/64 (46%) Frame = +1 Query: 187 YLNSVLQCLTYTEPFAAYLQSGRHKSSCRTAGFCALCALQNHVKTALQSTGKIVTPSQIV 366 Y+ SV+ + YT FA Y K+ + G CALC+ A+ ++ S +V Sbjct: 194 YIPSVVSYVLYTVIFATYALLRVRKALGKRKGACALCS----AAVAVSFVAFVLGASHMV 249 Query: 367 KNLR 378 ++ R Sbjct: 250 RHTR 253 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 50,748,825 Number of Sequences: 219361 Number of extensions: 933243 Number of successful extensions: 2615 Number of sequences better than 10.0: 111 Number of HSP's better than 10.0 without gapping: 2563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2601 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
