Clone Name | bastl40b02 |
---|---|
Clone Library Name | barley_pub |
>NUP88_HUMAN (Q99567) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) Length = 741 Score = 34.7 bits (78), Expect = 0.094 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 245 HVIAISPLHCICACDVKRFWFLP--RPPLLFVVASTQECVRWTNLS 376 H++ PL C ++ FW +P P + + ST EC+ W LS Sbjct: 451 HILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECLIWPLLS 496
>MSHR_MOUSE (Q01727) Melanocyte-stimulating hormone receptor (MSH-R)| (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) Length = 315 Score = 31.6 bits (70), Expect = 0.79 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%) Frame = +2 Query: 206 LLWSRFFTYSI*FHVIAISPLHCICACDVKRF-WFLPRPPLLFVVASTQECVRWTNLSR* 382 L W FF + + +I + P H C+C K F FL LL V++ST + + + S+ Sbjct: 250 LCWGPFFLHLL---LIVLCPQHPTCSCIFKNFNLFL----LLIVLSSTVDPLIYAFRSQE 302 Query: 383 PRISARTILFCT 418 R++ + +L C+ Sbjct: 303 LRMTLKEVLLCS 314
>NUP88_RAT (O08658) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) (Nucleoporin Nup84) Length = 742 Score = 30.0 bits (66), Expect = 2.3 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 245 HVIAISPLHCICACDVKRFWFLP--RPPLLFVVASTQECV 358 H++ PL C ++ FW +P P + + ST EC+ Sbjct: 452 HILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECL 491
>NUP88_MOUSE (Q8CEC0) Nuclear pore complex protein Nup88 (Nucleoporin Nup88) (88| kDa nuclear pore complex protein) Length = 753 Score = 30.0 bits (66), Expect = 2.3 Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 2/40 (5%) Frame = +2 Query: 245 HVIAISPLHCICACDVKRFWFLP--RPPLLFVVASTQECV 358 H++ PL C ++ FW +P P + + ST EC+ Sbjct: 452 HILCTKPLPCRQPAPIRGFWIVPDILGPTMICITSTYECL 491
>RS11_MYCPA (Q73S45) 30S ribosomal protein S11| Length = 138 Score = 28.9 bits (63), Expect = 5.1 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +1 Query: 121 PVKGGAASPKQGIQTQEKEPPSAPH 195 P K AA+PK+G +T+ +E + PH Sbjct: 3 PAKKAAAAPKKGQKTRRREKKNVPH 27
>LNT_CHLCV (Q824Q5) Apolipoprotein N-acyltransferase (EC 2.3.1.-) (ALP| N-acyltransferase) Length = 541 Score = 28.9 bits (63), Expect = 5.1 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +1 Query: 115 FFPVKGGAASPKQGIQTQEKEPPSAPHCSFLALVSLLYLFDLVPCDCHFS 264 FF + G A G+ EP +P S+ L SLL+L+ + HFS Sbjct: 24 FFSLLGSAVG--YGLLWYSLEPQKSPKLSWRQLTSLLFLWSVTVYGVHFS 71
>TYRO_AGABI (O42713) Tyrosinase (EC 1.14.18.1) (Monophenol monooxygenase)| (Phenolase) (Monophenol oxidase) (Cresolase) Length = 556 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 174 FFLCLDPLLWTCSTTLDREKMLWSA 100 FF DP+ W T +DR LW A Sbjct: 270 FFAAFDPIFWLHHTNVDRLLSLWKA 294
>LEU3_MYCPA (Q73VI1) 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (Beta-IPM| dehydrogenase) (IMDH) (3-IPM-DH) Length = 336 Score = 28.5 bits (62), Expect = 6.7 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 4/44 (9%) Frame = +2 Query: 101 ADQSIFSLSRVVLQVQSKGSRHRKKSLLVHR----TAASLLWSR 220 + + F + RVV+ + R RK LVH+ T A LWSR Sbjct: 148 SQNTAFGVRRVVVDAFERARRRRKHLTLVHKTNVLTFAGKLWSR 191 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,160,249 Number of Sequences: 219361 Number of extensions: 1148470 Number of successful extensions: 2908 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2838 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2903 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)