| Clone Name | bastl39h03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | BCTN5_BOVIN (P19660) Bactenecin-5 precursor (Bac5) (Cathelicidin... | 29 | 5.1 | 2 | WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7... | 28 | 8.7 | 3 | PO121_RAT (P52591) Nuclear envelope pore membrane protein POM 12... | 28 | 8.7 |
|---|
>BCTN5_BOVIN (P19660) Bactenecin-5 precursor (Bac5) (Cathelicidin-2) (PR-42)| Length = 176 Score = 29.3 bits (64), Expect = 5.1 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 3/34 (8%) Frame = +3 Query: 33 RPPIQLTIFSPLHP---PSVLPHFREPLHAPLSP 125 RPPI+ + P P P + P R P PL P Sbjct: 138 RPPIRPPFYPPFRPPIRPPIFPPIRPPFRPPLGP 171
>WNK2_HUMAN (Q9Y3S1) Serine/threonine-protein kinase WNK2 (EC 2.7.11.1)| (Protein kinase with no lysine 2) (Protein kinase, lysine-deficient 2) Length = 2297 Score = 28.5 bits (62), Expect = 8.7 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 8/56 (14%) Frame = +3 Query: 3 PQKLP-----QRRQARPPIQL-TIFSPLHPPSVLPHFREPL--HAPLSPSRSTGQP 146 PQ LP Q+ A P + + ++ +P PPS+ HF +P AP+ P ST P Sbjct: 663 PQSLPSLGAYQQPTAAPGLPVGSVPAPACPPSLQQHFPDPAMSFAPVLPPPSTPMP 718
>PO121_RAT (P52591) Nuclear envelope pore membrane protein POM 121 (Pore| membrane protein of 121 kDa) (P145) Length = 1199 Score = 28.5 bits (62), Expect = 8.7 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%) Frame = +3 Query: 6 QKLPQRRQARPPIQLTIFSPLHP--PSVLPHFREPLHAPLSPSRSTGQP 146 Q+ P + PP T+ +P P PS+L PL PL+ + S +P Sbjct: 580 QESPAPSSSEPPEAATVAAPSPPKTPSLLAPLVSPLTGPLASTSSDSKP 628 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,294,647 Number of Sequences: 219361 Number of extensions: 484253 Number of successful extensions: 1773 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1700 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1769 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)