| Clone Name | bastl39d07 |
|---|---|
| Clone Library Name | barley_pub |
>PHC3_MOUSE (Q8CHP6) Polyhomeotic-like protein 3| Length = 981 Score = 31.2 bits (69), Expect = 0.64 Identities = 13/40 (32%), Positives = 22/40 (55%), Gaps = 5/40 (12%) Frame = -2 Query: 355 RVPHHQLLISRYHSLVL-----TRSRPHPPQSHCLPVPKN 251 +V HHQLL+ + + + S+ PP HC+P+P + Sbjct: 316 KVSHHQLLLQQQQQQIQPITLQSPSQDPPPSQHCIPLPNH 355
>MCM7_XENLA (Q91876) DNA replication licensing factor MCM7 (CDC47 homolog)| (x.MCM7) Length = 720 Score = 30.8 bits (68), Expect = 0.84 Identities = 16/37 (43%), Positives = 23/37 (62%) Frame = +1 Query: 145 NSPFSAGSEPHPLHGRDSSLKTVEGNLQAAAAMASRF 255 N+ S + +P +GR + KTVE N+Q AA+ SRF Sbjct: 478 NARCSILAAANPAYGRYNPKKTVEQNIQLPAALLSRF 514
>RT23_SCHPO (Q9UR07) Retrotransposable element Tf2 155 kDa protein type 3| Length = 1333 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 340 QLLISRYHSLVLTRSRPHPPQSHCLPVPKNETPW 239 Q + H+ + +SR H P P+P +E PW Sbjct: 951 QEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPW 984
>RT22_SCHPO (Q9C0R2) Retrotransposable element Tf2 155 kDa protein type 2| Length = 1333 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 340 QLLISRYHSLVLTRSRPHPPQSHCLPVPKNETPW 239 Q + H+ + +SR H P P+P +E PW Sbjct: 951 QEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPW 984
>RT21_SCHPO (Q05654) Retrotransposable element Tf2 155 kDa protein type 1| Length = 1333 Score = 30.0 bits (66), Expect = 1.4 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -2 Query: 340 QLLISRYHSLVLTRSRPHPPQSHCLPVPKNETPW 239 Q + H+ + +SR H P P+P +E PW Sbjct: 951 QEYVQNCHTCQINKSRNHKPYGPLQPIPPSERPW 984
>SYH_PORPU (P51348) Histidyl-tRNA synthetase (EC 6.1.1.21) (Histidine--tRNA| ligase) (HisRS) Length = 430 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = +2 Query: 206 RQLKVIYKQQQPWRLVFGD----RETVTLRRMWTRSSQNKGVIARNQKL 340 +QLK +K++ L+ GD +ET+T++ M+T+ +N +I K+ Sbjct: 366 KQLKQAHKKRAIACLILGDNEIQQETITIKWMYTQEQENMSIIEFKNKI 414
>POLR_OYMV (P20127) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1776 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 16/48 (33%) Frame = -2 Query: 349 PHHQLLISRY------HSLVLTRSRPHPPQS----------HCLPVPK 254 PH L +S+ HSL++TR PH P S +CLP+P+ Sbjct: 227 PHLNLSVSKLESWGPVHSLLITRGLPHLPSSEKQQVSFHIPNCLPLPE 274
>HEMA_CVMA5 (P31615) Hemagglutinin-esterase precursor (EC 3.1.1.53) (HE) (E3| glycoprotein) Length = 428 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = -1 Query: 257 QKRDAMAAAACKLPSTVFKLESRPWSG*GSDPAENGE 147 ++ D M AAAC+LP F+ S +SG G+ A +G+ Sbjct: 309 RQSDNMTAAACQLPYCFFRNTSANYSG-GTHDAHHGD 344
>PHC3_HUMAN (Q8NDX5) Polyhomeotic-like protein 3 (hPH3) (Homolog of| polyhomeotic 3) (Early development regulatory protein 3) Length = 983 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 5/43 (11%) Frame = -2 Query: 355 RVPHHQLLISRYHS----LVLTRSRPHPPQS-HCLPVPKNETP 242 +V HHQL++ + + L S PP S HC+P+ + P Sbjct: 319 KVSHHQLILQQQQQQIQPITLQNSTQDPPPSQHCIPLQNHGLP 361
>EXTN_TOBAC (P13983) Extensin precursor (Cell wall hydroxyproline-rich| glycoprotein) Length = 620 Score = 24.3 bits (51), Expect(2) = 6.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +2 Query: 86 HPRPLSAAERAAAPVYSAAPILRSP 160 HP P + A+ P+YS +P ++ P Sbjct: 177 HPPPPTYAQPPPTPIYSPSPQVQPP 201 Score = 21.9 bits (45), Expect(2) = 6.9 Identities = 8/10 (80%), Positives = 8/10 (80%) Frame = +1 Query: 61 TPPVPQHPPS 90 TPP QHPPS Sbjct: 156 TPPRGQHPPS 165
>ZN161_HUMAN (Q14119) Zinc finger protein 161 (Putative transcription factor| DB1) Length = 516 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/41 (36%), Positives = 19/41 (46%), Gaps = 1/41 (2%) Frame = -2 Query: 361 AHRVPHHQLLISRYHSLVLTRSRPHPP-QSHCLPVPKNETP 242 AH HHQ ++ L L S PP Q LP+P + P Sbjct: 12 AHEASHHQQQAAQNSLLPLLSSAVEPPDQKPLLPIPITQKP 52
>PALH_NEUCR (Q7RY98) pH-response regulator protein palH/rim-21| Length = 778 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/16 (62%), Positives = 14/16 (87%) Frame = +1 Query: 313 GSDSEKSEAGDGGRDG 360 GSDS+ +E+G GG+DG Sbjct: 411 GSDSQDTESGGGGKDG 426 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.305 0.125 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,448,172 Number of Sequences: 219361 Number of extensions: 685212 Number of successful extensions: 1276 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 1221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1274 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits)