Clone Name | bastl39b04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PAX8_RAT (P51974) Paired box protein Pax-8 | 29 | 5.5 | 2 | Y066_NPVLD (P30325) Hypothetical protein in POL 5'region (Fragment) | 28 | 9.4 |
---|
>PAX8_RAT (P51974) Paired box protein Pax-8| Length = 458 Score = 29.3 bits (64), Expect = 5.5 Identities = 13/41 (31%), Positives = 20/41 (48%) Frame = -1 Query: 285 SVSGSEPAVASDPAPPQRILRQPFLDLVMVGSGGSLAPHLP 163 ++ P ++S + P + FLDL VGSGG +P Sbjct: 308 AIKQETPELSSSSSTPSSLSSSAFLDLQQVGSGGPAGASVP 348
>Y066_NPVLD (P30325) Hypothetical protein in POL 5'region (Fragment)| Length = 369 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 288 ASVSGSEPAVASDPAPPQRILRQPFLDLVMVGSGGSLA 175 A ++ SEP AS P+PP+ P V + S G A Sbjct: 118 APIAPSEPTPASAPSPPKADAPNPIQQNVYINSAGEAA 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,063,655 Number of Sequences: 219361 Number of extensions: 459349 Number of successful extensions: 1307 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1307 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)