Clone Name | bastl39a02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | METE_BIFLO (Q8G651) 5-methyltetrahydropteroyltriglutamate--homoc... | 29 | 7.8 | 2 | COX10_SCHPO (Q9Y7Y4) Protoheme IX farnesyltransferase, mitochond... | 29 | 7.8 | 3 | GUAA_PHOLL (Q7N3K4) GMP synthase [glutamine-hydrolyzing] (EC 6.3... | 29 | 7.8 |
---|
>METE_BIFLO (Q8G651) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 767 Score = 28.9 bits (63), Expect = 7.8 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 240 HEAEVELEASGAVVDGHRPRTPSE 169 H+A E EA V D H PR PSE Sbjct: 689 HDAHFETEAGPGVYDIHSPRIPSE 712
>COX10_SCHPO (Q9Y7Y4) Protoheme IX farnesyltransferase, mitochondrial precursor| (EC 2.5.1.-) (Heme O synthase) Length = 387 Score = 28.9 bits (63), Expect = 7.8 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = -1 Query: 454 LYHRPCAKNWVSICWFFVPGDLRYRCHFPTHILHRRLSIVCSLRKTCSISPSP 296 +Y RPC K + + G L PTHI + RLS + + T + +P P Sbjct: 14 IYTRPCLKRFYHQHYEHT-GKLSRTFFSPTHIKYNRLSTLDTSTSTANAAPDP 65
>GUAA_PHOLL (Q7N3K4) GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)| (Glutamine amidotransferase) (GMP synthetase) Length = 525 Score = 28.9 bits (63), Expect = 7.8 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +1 Query: 103 HELLAASGGGDVRVTLYEQEESLGGRARTVAVDDGAGRL 219 H +L SGG D VT ++G R V VD+G RL Sbjct: 229 HVILGLSGGVDSSVTALLLHRAIGNRLTCVFVDNGLLRL 267 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,450,081 Number of Sequences: 219361 Number of extensions: 995008 Number of successful extensions: 3097 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3096 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)