ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl38g12 |
|---|---|
| Clone Library Name | barley_pub |
>SYA_ARATH (P36428) Alanyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.7) (Alanine--tRNA ligase) (AlaRS) Length = 1003 Score = 42.7 bits (99), Expect = 3e-04 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = +1 Query: 124 PPMEEAAPDWPSALVRQVFIDFFRSRAHTPWPSSP 228 P E + WP+ VR ++DFFR + H WPSSP Sbjct: 50 PGSEPSETQWPAKRVRDTYVDFFRGKGHKFWPSSP 84
>SYA_LISMO (Q8Y722) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 879 Score = 33.9 bits (76), Expect = 0.12 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSSP 228 SA VRQ+F+DFF+ + HT PS+P Sbjct: 6 SAEVRQLFLDFFKEKGHTIEPSAP 29
>SYA_LISMF (Q71ZG6) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 879 Score = 33.9 bits (76), Expect = 0.12 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSSP 228 SA VRQ+F+DFF+ + HT PS+P Sbjct: 6 SAEVRQLFLDFFKEKGHTIEPSAP 29
>SYA_LISIN (Q92BK9) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 879 Score = 33.9 bits (76), Expect = 0.12 Identities = 14/24 (58%), Positives = 19/24 (79%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSSP 228 SA VRQ+F+DFF+ + HT PS+P Sbjct: 6 SAEVRQLFLDFFKEKGHTIEPSAP 29
>SYA_LACLA (Q9CEW0) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 872 Score = 32.7 bits (73), Expect = 0.26 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPS 222 SA VRQ+F+DFF+S+ HT PS Sbjct: 6 SAEVRQMFLDFFKSKGHTVEPS 27
>SYA_PSYAR (Q4FRQ0) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 890 Score = 32.0 bits (71), Expect = 0.44 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 SA +RQ FIDFF S+ HTP SS Sbjct: 7 SADIRQAFIDFFISKQHTPVASS 29
>SYA_SYMTH (Q67MV8) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 872 Score = 31.6 bits (70), Expect = 0.58 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 SA +RQ FIDFF+S+ H PSS Sbjct: 3 SAEIRQKFIDFFKSKGHVHVPSS 25
>SYA_BACSK (Q5WHM8) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 876 Score = 31.2 bits (69), Expect = 0.75 Identities = 13/23 (56%), Positives = 18/23 (78%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 SA VRQ+FIDFF+ + H+ PS+ Sbjct: 6 SASVRQMFIDFFKEKGHSVEPSA 28
>SYA_OCEIH (Q8EPS9) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 879 Score = 30.8 bits (68), Expect = 0.99 Identities = 12/23 (52%), Positives = 19/23 (82%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 SA +RQ+FIDFF+ ++H+ PS+ Sbjct: 6 SAEIRQMFIDFFKEKSHSVEPSA 28
>USP_CHOFU (O76202) Protein ultraspiracle homolog| Length = 472 Score = 30.8 bits (68), Expect = 0.99 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = +1 Query: 70 PAAAATIHLSSHRPSTAGPPMEEAAPDWPSALVRQVFIDFFRSRAHTP 213 P + T ++ RP+ GPP ++A P+A+++Q+ +S H P Sbjct: 10 PTMSVTALINWARPAPPGPPQPQSASPAPAAMLQQLPTQSMQSLNHIP 57
>BIOH_XANAC (Q8PQE0) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 253 Score = 30.4 bits (67), Expect = 1.3 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 6/40 (15%) Frame = +1 Query: 88 IHLSSHRPSTAGPPMEEAAP------DWPSALVRQVFIDF 189 +H ++ P G M A P DWPSA+ R+VF+ F Sbjct: 85 LHAAATLPQVRGLAMIAATPRFVRGSDWPSAVQREVFVQF 124
>SYA_BACLD (Q65GS5) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 878 Score = 30.0 bits (66), Expect = 1.7 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 SA VRQ+F+DFF+ + H PS+ Sbjct: 6 SAQVRQMFLDFFKEKGHAVEPSA 28
>SYA_HAEDU (Q7VLK0) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 874 Score = 30.0 bits (66), Expect = 1.7 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = +1 Query: 166 VRQVFIDFFRSRAHTPWPSS 225 +RQ F+DFF S+ HT PSS Sbjct: 7 IRQSFLDFFNSKGHTVVPSS 26
>SYA_BACSU (O34526) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 878 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 SA VRQ+F+DFF+ + H PS+ Sbjct: 6 SAEVRQMFLDFFKEKGHAVEPSA 28
>SYA_BACHD (Q9KDE6) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 879 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 SA VRQ+F+DFF+ + H PS+ Sbjct: 6 SAQVRQMFLDFFKEKGHDVEPSA 28
>SYA_NITEU (Q82TF8) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 863 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/24 (50%), Positives = 17/24 (70%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSSP 228 S+ +RQ F++FF +R H PSSP Sbjct: 3 SSEIRQKFLEFFEARGHVIVPSSP 26
>SYA_ENTFA (Q835J8) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 29.6 bits (65), Expect = 2.2 Identities = 11/23 (47%), Positives = 19/23 (82%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 S+ VRQ+++DFF+S+ H+ PS+ Sbjct: 6 SSQVRQMYLDFFKSKGHSVEPSA 28
>SYAC_SCHPO (O13914) Probable alanyl-tRNA synthetase, cytoplasmic (EC 6.1.1.7)| (Alanine--tRNA ligase) (AlaRS) Length = 959 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 133 EEAAPDWPSALVRQVFIDFFRSRAHTPWPSS 225 E +WP+ +R+ F+ +F HT PSS Sbjct: 4 ESEVVNWPANEIRRTFLKYFEDHGHTIVPSS 34
>SYA_BORPE (Q7VXE1) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 874 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 S+ +RQ F+ FF+S+ HT PSS Sbjct: 3 SSEIRQKFLQFFQSKGHTIVPSS 25
>SYA_BORPA (Q7W6N4) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 874 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 S+ +RQ F+ FF+S+ HT PSS Sbjct: 3 SSEIRQKFLQFFQSKGHTIVPSS 25
>SYA_BORBR (Q7WHL6) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 874 Score = 28.5 bits (62), Expect = 4.9 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 S+ +RQ F+ FF+S+ HT PSS Sbjct: 3 SSEIRQKFLQFFQSKGHTIVPSS 25
>SYA_PHOLL (Q7N7A5) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 876 Score = 28.1 bits (61), Expect = 6.4 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 +A +RQ F+DFF ++ H PSS Sbjct: 5 TAEIRQAFLDFFHTKGHQVVPSS 27
>SYA_CAMJR (Q5HVQ7) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 842 Score = 28.1 bits (61), Expect = 6.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 166 VRQVFIDFFRSRAHTPWPSSP 228 +R+ ++DFF S+ H PSSP Sbjct: 3 IRKAYLDFFASKGHEITPSSP 23
>SYA_CAMJE (Q9PI05) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 842 Score = 28.1 bits (61), Expect = 6.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 166 VRQVFIDFFRSRAHTPWPSSP 228 +R+ ++DFF S+ H PSSP Sbjct: 3 IRKAYLDFFASKGHEITPSSP 23
>SYAC_YEAST (P40825) Alanyl-tRNA synthetase, cytoplasmic (EC 6.1.1.7)| (Alanine--tRNA ligase) (AlaRS) Length = 958 Score = 28.1 bits (61), Expect = 6.4 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +1 Query: 151 WPSALVRQVFIDFFRSRAHTPWPSSP 228 W + VR F+D+F+S+ H SSP Sbjct: 9 WTATNVRNTFLDYFKSKEHKFVKSSP 34
>SYA_EHRCJ (Q3YSV8) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 887 Score = 28.1 bits (61), Expect = 6.4 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 166 VRQVFIDFFRSRAHTPWPSSP 228 +R++F+DFF H +PSSP Sbjct: 10 IRKLFVDFFIKNGHQLFPSSP 30
>POLR_OYMV (P20127) RNA replicase polyprotein (EC 2.7.7.48)| Length = 1776 Score = 28.1 bits (61), Expect = 6.4 Identities = 9/35 (25%), Positives = 22/35 (62%) Frame = +1 Query: 43 KPRARDRVLPAAAATIHLSSHRPSTAGPPMEEAAP 147 +P+ + ++ ++++ SSH+PS + P+E +P Sbjct: 580 QPQPWEEIISTFLSSLNASSHKPSPSSAPLESPSP 614
>SYA_BRUSU (P67009) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 885 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 166 VRQVFIDFFRSRAHTPWPSSP 228 +R F+D+FR H PSSP Sbjct: 7 IRSTFLDYFRKNGHEVVPSSP 27
>SYA_BRUME (P67008) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 885 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 166 VRQVFIDFFRSRAHTPWPSSP 228 +R F+D+FR H PSSP Sbjct: 7 IRSTFLDYFRKNGHEVVPSSP 27
>SYA_BRUAB (Q57CU0) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 885 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 166 VRQVFIDFFRSRAHTPWPSSP 228 +R F+D+FR H PSSP Sbjct: 7 IRSTFLDYFRKNGHEVVPSSP 27
>BIOH_XANOR (Q5H6D1) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 253 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 6/40 (15%) Frame = +1 Query: 88 IHLSSHRPSTAGPPMEEAAP------DWPSALVRQVFIDF 189 +H ++ P G M A P DWP A+ R++F+ F Sbjct: 85 LHAAATLPQVRGLAMIAATPRFVRGSDWPDAVQRELFVQF 124
>BIOH_XANCP (Q8PDF3) Carboxylesterase bioH (EC 3.1.1.1) (Biotin synthesis| protein bioH) Length = 253 Score = 27.7 bits (60), Expect = 8.3 Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 6/40 (15%) Frame = +1 Query: 88 IHLSSHRPSTAGPPMEEAAP------DWPSALVRQVFIDF 189 +H ++ +P M A P DWP A+ R+VF+ F Sbjct: 85 LHAAATQPQVRALAMIAATPRFVRGSDWPDAVEREVFVQF 124
>AOX_MONFR (Q96UR9) Alternative oxidase, mitochondrial precursor (EC 1.-.-.-)| (MfAOX1) Length = 358 Score = 27.7 bits (60), Expect = 8.3 Identities = 17/60 (28%), Positives = 25/60 (41%), Gaps = 1/60 (1%) Frame = +1 Query: 52 ARDRVLPAAAATIHLSSHRPSTAGPPMEEAAPD-WPSALVRQVFIDFFRSRAHTPWPSSP 228 A+ LP+ T H+ S RP T+G ++ D +P Q+ R WP P Sbjct: 27 AQSYALPSTKCTAHVPSRRPFTSGAKIQVKGRDLFPEPXHGQI------KRTEPAWPHPP 80
>SYA_STRA5 (Q8E0C4) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 872 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/23 (43%), Positives = 19/23 (82%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 SA +RQ+++DF++S+ H+ PS+ Sbjct: 6 SAQIRQMWLDFWKSKGHSVEPSA 28
>SYA_STRA3 (Q8E600) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 872 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/23 (43%), Positives = 19/23 (82%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 SA +RQ+++DF++S+ H+ PS+ Sbjct: 6 SAQIRQMWLDFWKSKGHSVEPSA 28
>TEGU_HHV11 (P10220) Large tegument protein (Virion protein UL36)| Length = 3164 Score = 27.7 bits (60), Expect = 8.3 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 3/41 (7%) Frame = +1 Query: 37 KSKPRARDRV---LPAAAATIHLSSHRPSTAGPPMEEAAPD 150 KS P+ + V +PA+ L+S P AGPP+ EA D Sbjct: 461 KSTPKGKTPVGAAVPASVPEPVLASAPPDPAGPPVAEAGED 501
>SYA_LACPL (Q88V10) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = +1 Query: 157 SALVRQVFIDFFRSRAHTPWPSS 225 S+ +RQ+++DFF + HT PS+ Sbjct: 6 SSEIRQMYLDFFHEKGHTIVPSA 28
>SYA_BACHK (Q6HDD7) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 160 ALVRQVFIDFFRSRAHTPWPSS 225 A +RQ+F+DFF+ + H PS+ Sbjct: 7 AQIRQMFLDFFQEKGHAVEPSA 28
>SYA_BACCZ (Q634F6) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 160 ALVRQVFIDFFRSRAHTPWPSS 225 A +RQ+F+DFF+ + H PS+ Sbjct: 7 AQIRQMFLDFFQEKGHAVEPSA 28
>SYA_BACCR (Q817Z0) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 160 ALVRQVFIDFFRSRAHTPWPSS 225 A +RQ+F+DFF+ + H PS+ Sbjct: 7 AQIRQMFLDFFQEKGHAVEPSA 28
>SYA_BACC1 (P61697) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 160 ALVRQVFIDFFRSRAHTPWPSS 225 A +RQ+F+DFF+ + H PS+ Sbjct: 7 AQIRQMFLDFFQEKGHAVEPSA 28
>SYA_BACAN (Q81LK0) Alanyl-tRNA synthetase (EC 6.1.1.7) (Alanine--tRNA ligase)| (AlaRS) Length = 880 Score = 27.7 bits (60), Expect = 8.3 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +1 Query: 160 ALVRQVFIDFFRSRAHTPWPSS 225 A +RQ+F+DFF+ + H PS+ Sbjct: 7 AQIRQMFLDFFQEKGHAVEPSA 28 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,577,924 Number of Sequences: 219361 Number of extensions: 417813 Number of successful extensions: 1617 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 1577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1615 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
