| Clone Name | bastl38g05 |
|---|---|
| Clone Library Name | barley_pub |
>CVCA_PEA (P13915) Convicilin precursor| Length = 571 Score = 30.4 bits (67), Expect = 1.9 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -1 Query: 156 QREGPQRCRGLNGEQRAAATERREWRGGIAEEKSSTGCLFRAPFLF 19 +RE P+ L + +RR R G EE+SS R PFLF Sbjct: 112 RREDPEERARLRHREERTKRDRRHQREGEEEERSSESQEHRNPFLF 157
>CVCB_PEA (P13919) Convicilin precursor (Fragment)| Length = 386 Score = 29.6 bits (65), Expect = 3.2 Identities = 17/46 (36%), Positives = 22/46 (47%) Frame = -1 Query: 156 QREGPQRCRGLNGEQRAAATERREWRGGIAEEKSSTGCLFRAPFLF 19 +RE P+ L + +RR R G EE+SS R PFLF Sbjct: 160 RREDPEERARLRHREERTKRDRRHQREGEEEERSSESQERRNPFLF 205
>GLND_AZOBR (Q8RQD1) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 933 Score = 28.9 bits (63), Expect = 5.4 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -2 Query: 284 KHSFTALQDTGDRTRLLELMINLDARRPP 198 KH F +D GD TR+ + +++RPP Sbjct: 347 KHYFLVAKDVGDLTRIFCAALEAESKRPP 375
>MAGI1_MOUSE (Q6RHR9) Membrane-associated guanylate kinase, WW and PDZ| domain-containing protein 1 (BAI1-associated protein 1) (BAP-1) (Membrane-associated guanylate kinase inverted 1) (MAGI-1) Length = 1471 Score = 28.1 bits (61), Expect = 9.2 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -1 Query: 156 QREGPQRCRGLNGEQRAAATERREWR 79 QR P+R RG + E+RA +T+RR R Sbjct: 1389 QRRSPERRRGGSPERRAKSTDRRRAR 1414
>K1M1_SHEEP (P02534) Keratin, type I microfibrillar 48 kDa, component 8C-1| (Low-sulfur keratin) Length = 412 Score = 28.1 bits (61), Expect = 9.2 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = +2 Query: 71 IPPLHSLLSVAAARCSPLSPRHRCGP 148 I P S AA C+P PR RCGP Sbjct: 381 ITPCISSPCAPAAPCTPCVPRSRCGP 406
>MAGI1_HUMAN (Q96QZ7) Membrane-associated guanylate kinase, WW and PDZ| domain-containing protein 1 (BAI1-associated protein 1) (BAP-1) (Membrane-associated guanylate kinase inverted 1) (MAGI-1) (Atrophin-1-interacting protein 3) (AIP3) (WW domain-containi Length = 1491 Score = 28.1 bits (61), Expect = 9.2 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -1 Query: 156 QREGPQRCRGLNGEQRAAATERREWR 79 QR P+R RG + E+RA +T+RR R Sbjct: 1409 QRRSPERRRGGSPERRAKSTDRRRAR 1434
>NPY6R_RABIT (P79217) Neuropeptide Y receptor type 6 (NPY6-R)| Length = 371 Score = 28.1 bits (61), Expect = 9.2 Identities = 9/13 (69%), Positives = 12/13 (92%) Frame = -2 Query: 41 YFVPLSFLFVCFL 3 YFVPL F+F+C+L Sbjct: 218 YFVPLGFMFICYL 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,524,858 Number of Sequences: 219361 Number of extensions: 1036314 Number of successful extensions: 3000 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2999 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)