Clone Name | bastl33g12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PUR5_OCEIH (Q8ES94) Phosphoribosylformylglycinamidine cyclo-liga... | 30 | 3.1 | 2 | RNZ_CAEEL (O44476) Ribonuclease Z (EC 3.1.26.11) (RNase Z) (tRNa... | 30 | 4.1 | 3 | PUR5_SYNEL (Q8DHY2) Phosphoribosylformylglycinamidine cyclo-liga... | 29 | 6.9 | 4 | MYO52_SCHPO (O94477) Myosin-52 (Myosin type V-2) | 29 | 6.9 |
---|
>PUR5_OCEIH (Q8ES94) Phosphoribosylformylglycinamidine cyclo-ligase (EC| 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase) Length = 339 Score = 30.0 bits (66), Expect = 3.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +1 Query: 331 VGVDLQQFCIQRITAFGSNPIIHLEITAC 417 VG+DL C+ I A G +P+ L+ AC Sbjct: 80 VGIDLVAMCVNDIIAQGGDPLFFLDYIAC 108
>RNZ_CAEEL (O44476) Ribonuclease Z (EC 3.1.26.11) (RNase Z) (tRNase Z) (tRNA 3| endonuclease) (Homolog of ELAC2 protein 1) (CeELAC2) Length = 833 Score = 29.6 bits (65), Expect = 4.1 Identities = 14/56 (25%), Positives = 30/56 (53%) Frame = +1 Query: 232 FPRLHATSWNSLVPKSFFHSGRYQEIIQVSHL*VGVDLQQFCIQRITAFGSNPIIH 399 FP LH W+ ++ ++ S R + I+V+ +Q++ ++R +F PI++ Sbjct: 409 FPALHPIDWSGIITQNEELSQRQDQFIRVA------PMQRYWMRRGASFNEEPIVN 458
>PUR5_SYNEL (Q8DHY2) Phosphoribosylformylglycinamidine cyclo-ligase (EC| 6.3.3.1) (AIRS) (Phosphoribosyl-aminoimidazole synthetase) (AIR synthase) Length = 341 Score = 28.9 bits (63), Expect = 6.9 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +1 Query: 322 HL*VGVDLQQFCIQRITAFGSNPIIHLEITAC 417 H VG+DL C+ + G+ P+ L+ AC Sbjct: 74 HNTVGIDLVAMCVNDVLTCGAEPLFFLDYIAC 105
>MYO52_SCHPO (O94477) Myosin-52 (Myosin type V-2)| Length = 1516 Score = 28.9 bits (63), Expect = 6.9 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -1 Query: 393 DGITPKGSDTLNAELLQIHTHSEVRDLNDLLI 298 +G K DT++ ELL++ T+S+V + DL++ Sbjct: 584 EGFIDKNRDTISDELLELFTNSDVPFVKDLVL 615 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,835,868 Number of Sequences: 219361 Number of extensions: 1214835 Number of successful extensions: 3105 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3105 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)