Clone Name | bastl33d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YC47_SCHPO (O14053) Hypothetical WD-repeat protein C1672.07 in c... | 49 | 3e-06 | 2 | YL409_YEAST (Q06078) Hypothetical 104.8 kDa Trp-Asp repeats-cont... | 42 | 5e-04 | 3 | WDR36_HUMAN (Q8NI36) WD repeat-containing protein 36 (T-cell act... | 33 | 0.14 | 4 | Y111_METJA (Q57575) Hypothetical protein MJ0111 | 28 | 6.1 |
---|
>YC47_SCHPO (O14053) Hypothetical WD-repeat protein C1672.07 in chromosome III| Length = 902 Score = 48.9 bits (115), Expect = 3e-06 Identities = 22/48 (45%), Positives = 31/48 (64%) Frame = +3 Query: 132 IFEPFRAIGYITTGGVPFSLQRLGTETFVTVSVGKAFHVYNCAKLTLV 275 I+ PFR+IG+++ VPF ++ GT VT SVG F Y+C KL L+ Sbjct: 23 IYAPFRSIGHVSNA-VPFDIEARGTHFLVTTSVGNTFQTYDCEKLNLL 69
>YL409_YEAST (Q06078) Hypothetical 104.8 kDa Trp-Asp repeats-containing protein| in RPL31B-VIP1 intergenic region Length = 939 Score = 41.6 bits (96), Expect = 5e-04 Identities = 20/48 (41%), Positives = 29/48 (60%) Frame = +3 Query: 132 IFEPFRAIGYITTGGVPFSLQRLGTETFVTVSVGKAFHVYNCAKLTLV 275 IF PFR IG ++ G VPF+ LG+ ++ VGK F +Y+ L L+ Sbjct: 23 IFSPFRIIGNVSNG-VPFATGTLGSTFYIVTCVGKTFQIYDANTLHLL 69
>WDR36_HUMAN (Q8NI36) WD repeat-containing protein 36 (T-cell activation WD| repeat-containing protein) (TA-WDRP) Length = 951 Score = 33.5 bits (75), Expect = 0.14 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%) Frame = +3 Query: 132 IFEPFRAIGYITTGGVPFSLQ--RLGTETFVTVSVGKAFHVYNCAKLTLV 275 +F FRA+G + + +P ++ L +VT VGK+FH Y+ KL+LV Sbjct: 69 LFAGFRALG-LFSNDIPHVVRFSALKRRFYVTTCVGKSFHTYDVQKLSLV 117
>Y111_METJA (Q57575) Hypothetical protein MJ0111| Length = 396 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +3 Query: 174 GVPFSLQRLGTETFVTVSVGKAFH 245 GVPF L G + F V+ GKA+H Sbjct: 141 GVPFELTLEGAKKFAEVAKGKAYH 164 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.126 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,967,293 Number of Sequences: 219361 Number of extensions: 208522 Number of successful extensions: 660 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 645 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 656 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits)