Clone Name | bastl33c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | INHA_BOVIN (P07994) Inhibin alpha chain precursor | 29 | 5.9 | 2 | ADA1B_MOUSE (P97717) Alpha-1B adrenergic receptor (Alpha 1B-adre... | 28 | 7.7 | 3 | ADA1B_RAT (P15823) Alpha-1B adrenergic receptor (Alpha 1B-adreno... | 28 | 7.7 |
---|
>INHA_BOVIN (P07994) Inhibin alpha chain precursor| Length = 360 Score = 28.9 bits (63), Expect = 5.9 Identities = 15/37 (40%), Positives = 22/37 (59%) Frame = +2 Query: 299 VFLLVVLALRGRGASGLDADGELLMAFRRAVTADPLG 409 + LL++ G G GL+ D EL++A RA+ D LG Sbjct: 5 LLLLLLAPQGGHGCHGLELDRELVLAKVRALFLDALG 41
>ADA1B_MOUSE (P97717) Alpha-1B adrenergic receptor (Alpha 1B-adrenoceptor)| (Alpha 1B-adrenoreceptor) Length = 514 Score = 28.5 bits (62), Expect = 7.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 211 SFVRSFGCNCNGGQEARRR 267 +F+R GC C GG+ RRR Sbjct: 357 AFMRILGCQCRGGRRRRRR 375
>ADA1B_RAT (P15823) Alpha-1B adrenergic receptor (Alpha 1B-adrenoceptor)| (Alpha 1B-adrenoreceptor) Length = 515 Score = 28.5 bits (62), Expect = 7.7 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 211 SFVRSFGCNCNGGQEARRR 267 +F+R GC C GG+ RRR Sbjct: 358 AFMRILGCQCRGGRRRRRR 376 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,867,261 Number of Sequences: 219361 Number of extensions: 504630 Number of successful extensions: 1399 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1372 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1398 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)