Clone Name | bastl33c05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BRO1_ASPFU (Q4X0Z5) Vacuolar protein-sorting protein bro1 (BRO d... | 30 | 3.8 | 2 | SYNPO_HUMAN (Q8N3V7) Synaptopodin | 29 | 5.0 |
---|
>BRO1_ASPFU (Q4X0Z5) Vacuolar protein-sorting protein bro1 (BRO| domain-containing protein 1) Length = 976 Score = 29.6 bits (65), Expect = 3.8 Identities = 16/39 (41%), Positives = 19/39 (48%) Frame = +3 Query: 36 RQLPDQACLRPSPTSTPLFLRASQKMLAHSPKVACGGRP 152 RQL ++ P PTSTPL A K + P V G P Sbjct: 766 RQLMERLSTEPKPTSTPLPSTAPSKAKSPPPPVKAPGYP 804
>SYNPO_HUMAN (Q8N3V7) Synaptopodin| Length = 929 Score = 29.3 bits (64), Expect = 5.0 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 8/59 (13%) Frame = +3 Query: 9 RTTPRIILRRQLPDQACLRPSPTSTPLF-LRASQKMLAH-------SPKVACGGRPATV 161 RT P + LP+ LRP PT P + LR S +L+ SP+ A +P+++ Sbjct: 782 RTPPASLYHGYLPENGVLRPEPTKQPPYQLRPSLFVLSPIKEPAKVSPRAASPAKPSSL 840 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,802,903 Number of Sequences: 219361 Number of extensions: 857287 Number of successful extensions: 2429 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2429 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)