Clone Name | bastl33b07 |
---|---|
Clone Library Name | barley_pub |
>NOTC3_RAT (Q9R172) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2319 Score = 30.4 bits (67), Expect = 1.3 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 7/52 (13%) Frame = +1 Query: 40 GGDVPGGAYIATGLLSAIAV-----HLTNPSPPAPA--LPTRTHSKVPNRAS 174 G PGG ++ GLL+ +AV L P+PP P+ LP S++ N A+ Sbjct: 2150 GRQPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGSQLLNPAT 2201
>NOTC3_HUMAN (Q9UM47) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2321 Score = 28.5 bits (62), Expect = 4.9 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = +1 Query: 40 GGDVPGGAYIATGLLSAIAV-----HLTNPSPPAPA 132 G PGG ++ GLL+ +AV L P+PP P+ Sbjct: 2149 GRQPPGGCVLSLGLLNPVAVPLDWARLPPPAPPGPS 2184
>NOTC3_MOUSE (Q61982) Neurogenic locus notch homolog protein 3 precursor (Notch 3)| [Contains: Notch 3 extracellular truncation; Notch 3 intracellular domain] Length = 2318 Score = 28.1 bits (61), Expect = 6.4 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = +1 Query: 40 GGDVPGGAYIATGLLSAIAV-----HLTNPSPPAPA 132 G PGG ++ GLL+ +AV L P+PP P+ Sbjct: 2149 GRQPPGGCVLSFGLLNPVAVPLDWARLPPPAPPGPS 2184
>RHLB_XANOR (Q5GUR8) ATP-dependent RNA helicase rhlB (EC 3.6.1.-)| Length = 574 Score = 27.7 bits (60), Expect = 8.4 Identities = 16/41 (39%), Positives = 20/41 (48%) Frame = +1 Query: 22 VPLVVHGGDVPGGAYIATGLLSAIAVHLTNPSPPAPALPTR 144 +P+ + GGDV G A TG A V + N PAL R Sbjct: 40 LPVALPGGDVAGQAQTGTGKTLAFLVAVMNRLLNRPALADR 80
>MMT1_HORVU (Q9MBC2) Methionine S-methyltransferase (EC 2.1.1.12) (AdoMet:Met| S-methyltransferase) (Hv-MMT1) Length = 1088 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 189 MAAAAGDVEAFLA 227 MAAAAGDVEAFLA Sbjct: 1 MAAAAGDVEAFLA 13
>SYFB_CLOAB (Q97GL0) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 792 Score = 27.7 bits (60), Expect = 8.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 10 ELTVVPLVVHGGDVPGGAYIATGLLSAI 93 E +VP+ +HG +PGG I G L + Sbjct: 86 ENDIVPVALHGSTLPGGVKIKKGKLRGV 113 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,704,480 Number of Sequences: 219361 Number of extensions: 419025 Number of successful extensions: 2322 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2063 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2317 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)