| Clone Name | bastl32h06 |
|---|---|
| Clone Library Name | barley_pub |
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 29.6 bits (65), Expect = 2.3 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Frame = -3 Query: 146 PKFPARRMQKAGLHE*HSDLRFRT*SPT-----TSGQGGRARSPTPPPQARKK 3 PK + + G HS R + SP TS +G R RSP+PPP R++ Sbjct: 507 PKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPPPTRRRR 559
>LIPA2_MOUSE (Q8BSS9) Liprin-alpha-2 (Protein tyrosine phosphatase receptor type| f polypeptide-interacting protein alpha-2) (PTPRF-interacting protein alpha-2) Length = 1257 Score = 28.5 bits (62), Expect = 5.2 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 7/58 (12%) Frame = -3 Query: 161 NTPK-TPKFPARRMQKAGLHE*HSDLRFRT*SPTTSGQGGRARSPT------PPPQAR 9 +TPK TP+ PAR M + G+ SDLR + GR T PPP R Sbjct: 723 STPKLTPRSPAREMDRMGVMTLPSDLRKHRRKIAVVEEDGREDKATIKCETSPPPTPR 780
>LIPA2_HUMAN (O75334) Liprin-alpha-2 (Protein tyrosine phosphatase receptor type| f polypeptide-interacting protein alpha-2) (PTPRF-interacting protein alpha-2) Length = 1257 Score = 28.5 bits (62), Expect = 5.2 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 7/58 (12%) Frame = -3 Query: 161 NTPK-TPKFPARRMQKAGLHE*HSDLRFRT*SPTTSGQGGRARSPT------PPPQAR 9 +TPK TP+ PAR M + G+ SDLR + GR T PPP R Sbjct: 723 STPKLTPRSPAREMDRMGVMTLPSDLRKHRRKIAVVEEDGREDKATIKCETSPPPTPR 780
>SRPK1_HUMAN (Q96SB4) Serine/threonine-protein kinase SRPK1 (EC 2.7.11.1)| (Serine/arginine-rich protein-specific kinase 1) (SR-protein-specific kinase 1) (SFRS protein kinase 1) Length = 826 Score = 28.1 bits (61), Expect = 6.8 Identities = 13/37 (35%), Positives = 18/37 (48%) Frame = -1 Query: 172 TAPKTPPKHPSFQLAVCKRLACTNSTAT*DSEPDPQQ 62 T P+TPP HP+ L A A+ +P P+Q Sbjct: 106 TRPETPPAHPARALLCAPWAASPTPAASPSPQPPPRQ 142
>BD02_HUMAN (O15263) Beta-defensin 2 precursor (BD-2) (hBD-2) (Defensin, beta| 2) (Skin-antimicrobial peptide 1) (SAP1) Length = 64 Score = 28.1 bits (61), Expect = 6.8 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 3/42 (7%) Frame = +1 Query: 43 LPPCPDV---VGDQVLNLKSLCYSCKPAFCIRRAGNLGVLGV 159 L P P V +GD V LKS C P FC RR +G G+ Sbjct: 15 LMPLPGVFGGIGDPVTCLKSGAI-CHPVFCPRRYKQIGTCGL 55
>Y1463_METTH (Q50500) Hypothetical protein MTH1463 (ORF11)| Length = 142 Score = 27.7 bits (60), Expect = 8.9 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +1 Query: 64 VGDQVLNLKSLCYSCKPAFCIRRAGNLGV 150 +GD+V+ ++S YSC PA NLGV Sbjct: 10 LGDEVIVMQSRSYSCGPAALATVLRNLGV 38
>KITH_MYCMO (Q6KH30) Thymidine kinase (EC 2.7.1.21)| Length = 200 Score = 27.7 bits (60), Expect = 8.9 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 64 VGDQVLNLKSLCYSCKPA 117 + D VL LK++C+SCK A Sbjct: 134 IADDVLKLKAVCFSCKNA 151
>COAT_TRVCA (P05070) Coat protein (Capsid protein)| Length = 223 Score = 27.7 bits (60), Expect = 8.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -3 Query: 71 SPTTSGQGGRARSPTPPP 18 +P TSG G +PTPPP Sbjct: 204 APPTSGSSGSGAAPTPPP 221
>CX020_HUMAN (Q8NDZ0) Protein CXorf20| Length = 799 Score = 27.7 bits (60), Expect = 8.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +1 Query: 1 FFFLACGGGVGERALPPCPDVVGDQVLN 84 FF L+ +R PPCP GDQ+++ Sbjct: 107 FFHLSLPSSWDDRRTPPCPVAHGDQIVS 134 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,488,831 Number of Sequences: 219361 Number of extensions: 411956 Number of successful extensions: 1811 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1808 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)