Clone Name | bastl32d12 |
---|---|
Clone Library Name | barley_pub |
>SIN3B_HUMAN (O75182) Paired amphipathic helix protein Sin3b (Transcriptional| corepressor Sin3b) (Histone deacetylase complex subunit Sin3b) Length = 1162 Score = 32.0 bits (71), Expect = 0.49 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -1 Query: 90 TGEGGWIGRGASGSNWDRGG*EAHER 13 +G GG GRG SG+ W R G HE+ Sbjct: 11 SGAGGPAGRGLSGARWGRSGSAGHEK 36
>SIN3B_MOUSE (Q62141) Paired amphipathic helix protein Sin3b (Transcriptional| corepressor Sin3b) (Histone deacetylase complex subunit Sin3b) Length = 1098 Score = 31.2 bits (69), Expect = 0.83 Identities = 13/25 (52%), Positives = 14/25 (56%) Frame = -1 Query: 87 GEGGWIGRGASGSNWDRGG*EAHER 13 G GG GRG GS W R G HE+ Sbjct: 5 GSGGSAGRGFGGSRWGRSGSGGHEK 29
>MCHR1_MACMU (Q8MJ89) Melanin-concentrating hormone receptor 1 (MCH receptor 1)| (MCHR-1) (MCH-R1) (MCH1R) (MCH-1R) (MCHR) (G-protein coupled receptor 24) (Fragment) Length = 388 Score = 28.5 bits (62), Expect = 5.4 Identities = 11/32 (34%), Positives = 16/32 (50%), Gaps = 4/32 (12%) Frame = -1 Query: 126 PRESGRR----RPDWATGEGGWIGRGASGSNW 43 P + GRR +P W G W+ A+G+ W Sbjct: 4 PGQGGRRWRLPQPAWVEGSSAWLWEPATGTGW 35
>APS1_SCHPO (Q09790) Diphosphoinositol polyphosphate phosphohydrolase aps1 (EC| 3.6.1.52) (Diadenosine 5',5'''-P1,P6-hexaphosphate hydrolase) (EC 3.6.1.-) (Ap6A hydrolase) Length = 210 Score = 28.5 bits (62), Expect = 5.4 Identities = 12/41 (29%), Positives = 18/41 (43%), Gaps = 5/41 (12%) Frame = -1 Query: 117 SGRRRPDWATGEGGW-----IGRGASGSNWDRGG*EAHERR 10 S ++ P W +GGW + + A W+ GG H R Sbjct: 62 SAKKHPSWVVPKGGWEADESVQQAALREGWEEGGLVGHITR 102
>DBP2_YARLI (Q6C4D4) ATP-dependent RNA helicase DBP2 (EC 3.6.1.-)| Length = 552 Score = 28.1 bits (61), Expect = 7.1 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -1 Query: 87 GEGGWIGRGASGSNWDRGG 31 G GGW GRG G RGG Sbjct: 502 GRGGWGGRGGRGGRGGRGG 520
>SMG1_DROME (Q70PP2) Serine/threonine-protein kinase Smg1 (EC 2.7.11.1)| Length = 3218 Score = 27.7 bits (60), Expect = 9.2 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 93 ATGEGGWIGRGASGSNWDRGG*EAHE 16 ATG G G G S S W GG ++H+ Sbjct: 56 ATGSGNIAGLGGSESMWSPGGGKSHD 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,178,253 Number of Sequences: 219361 Number of extensions: 134349 Number of successful extensions: 622 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 564 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 622 length of database: 80,573,946 effective HSP length: 19 effective length of database: 76,406,087 effective search space used: 1833746088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)