Clone Name | bastl32d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MNN1_YEAST (P39106) Alpha-1,3-mannosyltransferase MNN1 (EC 2.4.1.-) | 30 | 3.1 | 2 | SYL2_SULSO (O33768) Leucyl-tRNA synthetase 2 (EC 6.1.1.4) (Leuci... | 29 | 4.0 |
---|
>MNN1_YEAST (P39106) Alpha-1,3-mannosyltransferase MNN1 (EC 2.4.1.-)| Length = 762 Score = 29.6 bits (65), Expect = 3.1 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -3 Query: 418 DESSF*KTTCMLMNSLNSIFPDVDPERTEGATVFVFPELRSPFSQKRTTE 269 D+ S + L+ +LN+ FP+ DP+ + F F PF TTE Sbjct: 209 DKMSKERVQSKLIKTLNATFPNYDPDNFKKYDQFEFEHKMFPFINNFTTE 258
>SYL2_SULSO (O33768) Leucyl-tRNA synthetase 2 (EC 6.1.1.4) (Leucine--tRNA| ligase 2) (LeuRS 2) Length = 944 Score = 29.3 bits (64), Expect = 4.0 Identities = 23/71 (32%), Positives = 33/71 (46%) Frame = +3 Query: 81 LFPSIVFGSLHCVWIHPDRFSVSAMVLGLRTKTKKDAAIHVDFNIFIQEISPWPPSESLK 260 L P +FG+ +WI+P V A +LG + + AA + F I EI E +K Sbjct: 217 LRPETIFGAT-ALWINPSEMYVVASMLGKKMILSEKAAAKLSFQIDDIEI-----EEKIK 270 Query: 261 SLRSVVLFWEN 293 + V L EN Sbjct: 271 GSKLVGLKVEN 281 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,240,023 Number of Sequences: 219361 Number of extensions: 1233980 Number of successful extensions: 2745 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2702 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2745 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2336739400 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)