| Clone Name | bastl32a10 |
|---|---|
| Clone Library Name | barley_pub |
>IRX2_MOUSE (P81066) Iroquois-class homeodomain protein IRX-2 (Iroquois| homeobox protein 2) (Homeodomain protein IRXA2) Length = 474 Score = 30.4 bits (67), Expect = 2.9 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 5/47 (10%) Frame = +2 Query: 173 SPCSGHAAPSPPTQPRAASPGASRRLRPVGGRVAATAP-----PRLW 298 SP +G AP P AA G S P+G R + AP P+LW Sbjct: 287 SPLTGVEAPLLSPAPEAAPRGGSGGKTPLGSRTSPGAPPPASKPKLW 333
>NDF2_RAT (Q63689) Neurogenic differentiation factor 2 (NeuroD2) (Brain bHLH| protein KW8) Length = 382 Score = 30.4 bits (67), Expect = 2.9 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +2 Query: 185 GHAAPSPPTQPRAASPGASRRLRPVGGRVAATAPPRL 295 G A P PP P + +PG +R +PV R P L Sbjct: 34 GDAPPQPPPAPGSGAPGPARATKPVSLRGEEVPEPTL 70
>HRX_MOUSE (P55200) Zinc finger protein HRX (ALL-1) (Fragment)| Length = 3866 Score = 30.0 bits (66), Expect = 3.7 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +2 Query: 161 VQRRSPCSGHAAPSPPTQPRAASPGASRRLRPVGGRVAATAPPR 292 V+ +S G AP+P +P+ S ASR+ + AA PP+ Sbjct: 1164 VEEKSEEGGAPAPAPAPEPKQVSAPASRKSSKQVSQPAAVVPPQ 1207
>PDC6I_MOUSE (Q9WU78) Programmed cell death 6-interacting protein| (ALG-2-interacting protein X) (ALG-2-interacting protein 1) (E2F1-inducible protein) (Eig2) Length = 869 Score = 29.6 bits (65), Expect = 4.9 Identities = 20/67 (29%), Positives = 24/67 (35%), Gaps = 20/67 (29%) Frame = +2 Query: 152 PLAVQRRSPCSGHAA--------------------PSPPTQPRAASPGASRRLRPVGGRV 271 P + SP +GHAA P PP P P AS P G Sbjct: 723 PPPAYQSSPAAGHAAAPPTPAPRTMPPAKPQPPARPPPPVLPANRVPPASAAAAPAGVGT 782 Query: 272 AATAPPR 292 A+ APP+ Sbjct: 783 ASAAPPQ 789
>NDF2_MOUSE (Q62414) Neurogenic differentiation factor 2 (NeuroD2)| (NeuroD-related factor) (NDRF) Length = 383 Score = 29.6 bits (65), Expect = 4.9 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +2 Query: 185 GHAAPSPPTQPRAASPGASRRLRPVGGRVAATAP 286 G A P PP P + +PG +R +PV R P Sbjct: 34 GDAPPQPPPAPGSGAPGPARAAKPVSLRGGEEIP 67
>AL_DROME (Q06453) Homeobox protein aristaless| Length = 408 Score = 29.6 bits (65), Expect = 4.9 Identities = 15/28 (53%), Positives = 17/28 (60%) Frame = +2 Query: 164 QRRSPCSGHAAPSPPTQPRAASPGASRR 247 QR+ P H AP PP PRAA+P RR Sbjct: 351 QRQLPPPSHQAPPPP--PRAATPPEDRR 376
>CO7A1_HUMAN (Q02388) Collagen alpha-1(VII) chain precursor (Long-chain collagen)| (LC collagen) Length = 2944 Score = 29.3 bits (64), Expect = 6.4 Identities = 13/38 (34%), Positives = 15/38 (39%) Frame = +2 Query: 176 PCSGHAAPSPPTQPRAASPGASRRLRPVGGRVAATAPP 289 P GH P PP P A P + + G T PP Sbjct: 2178 PVGGHGDPGPPGAPGLAGPAGPQGPSGLKGEPGETGPP 2215
>ATBF1_MOUSE (Q61329) Alpha-fetoprotein enhancer-binding protein (AT motif-binding| factor) (AT-binding transcription factor 1) Length = 3726 Score = 29.3 bits (64), Expect = 6.4 Identities = 19/44 (43%), Positives = 23/44 (52%), Gaps = 5/44 (11%) Frame = +2 Query: 173 SPCSGHAAPSPPTQPRA----ASPGASRRL-RPVGGRVAATAPP 289 S + H+ SPP A ASP ASR+ PVG R +A PP Sbjct: 3610 SQSAAHSNDSPPPPSAAPSSSASPHASRKSWPPVGSRASAAKPP 3653
>MUC13_MOUSE (P19467) Mucin-13 precursor (Cell surface antigen 114/A10)| (Lymphocyte antigen 64) Length = 573 Score = 29.3 bits (64), Expect = 6.4 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 12/57 (21%) Frame = +2 Query: 152 PLAVQRRSP---------CSGHAAPSPPTQPRAASPGASRR---LRPVGGRVAATAP 286 P VQ +SP S SPPT ++ SPG+S + +P GG ++T P Sbjct: 170 PTTVQSQSPGSSSQVSTTTSSSGGASPPTTVQSQSPGSSSQPGPTQPSGGASSSTVP 226
>NACAM_MOUSE (P70670) Nascent polypeptide-associated complex alpha subunit,| muscle-specific form (Alpha-NAC, muscle-specific form) Length = 2187 Score = 28.9 bits (63), Expect = 8.3 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = +2 Query: 173 SPCSGHAAPSPPTQPRAASPG---ASRRLRPVGGRVAATAPPRL 295 SP PS PR ++P AS ++PV +A TAPP L Sbjct: 1579 SPTKSPKIPSSKKAPRTSAPKEFPASPSIKPVTTSLAQTAPPSL 1622
>CREA_BOTCI (O94130) DNA-binding protein creA (Carbon catabolite repressor)| Length = 435 Score = 28.9 bits (63), Expect = 8.3 Identities = 16/39 (41%), Positives = 20/39 (51%), Gaps = 1/39 (2%) Frame = +2 Query: 152 PLAVQRRSPCSGHAAPSP-PTQPRAASPGASRRLRPVGG 265 P++ SP H + SP P A+P S RLRP GG Sbjct: 291 PMSTAPSSPTFSHDSLSPTPDHTPLATPAHSPRLRPFGG 329 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,958,480 Number of Sequences: 219361 Number of extensions: 708928 Number of successful extensions: 3519 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3125 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3504 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)