Clone Name | bastl32a05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COAT_PLRVW (P11624) Coat protein | 30 | 2.5 | 2 | COAT_PLRVR (P17521) Coat protein | 30 | 2.5 | 3 | COAT_PLRV1 (P17522) Coat protein | 30 | 2.5 | 4 | COAT_PLRV (P10470) Coat protein | 30 | 2.5 | 5 | NTAL_HUMAN (Q9GZY6) Linker for activation of T-cells family memb... | 29 | 7.2 |
---|
>COAT_PLRVW (P11624) Coat protein| Length = 208 Score = 30.4 bits (67), Expect = 2.5 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 478 RRRRRGGGWSAKRADLGVPRGRG 410 RRRRRGG ++R GVPRGRG Sbjct: 47 RRRRRGGNRRSRRT--GVPRGRG 67
>COAT_PLRVR (P17521) Coat protein| Length = 208 Score = 30.4 bits (67), Expect = 2.5 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 478 RRRRRGGGWSAKRADLGVPRGRG 410 RRRRRGG ++R GVPRGRG Sbjct: 47 RRRRRGGNRRSRRT--GVPRGRG 67
>COAT_PLRV1 (P17522) Coat protein| Length = 208 Score = 30.4 bits (67), Expect = 2.5 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 478 RRRRRGGGWSAKRADLGVPRGRG 410 RRRRRGG ++R GVPRGRG Sbjct: 47 RRRRRGGNRRSRRT--GVPRGRG 67
>COAT_PLRV (P10470) Coat protein| Length = 208 Score = 30.4 bits (67), Expect = 2.5 Identities = 15/23 (65%), Positives = 17/23 (73%) Frame = -1 Query: 478 RRRRRGGGWSAKRADLGVPRGRG 410 RRRRRGG ++R GVPRGRG Sbjct: 47 RRRRRGGNRRSRRT--GVPRGRG 67
>NTAL_HUMAN (Q9GZY6) Linker for activation of T-cells family member 2| (Non-T-cell activation linker) (Linker for activation of B-cells) (Membrane-associated adapter molecule) (Williams-Beuren syndrome critical region 15 protein) Length = 243 Score = 28.9 bits (63), Expect = 7.2 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 2/43 (4%) Frame = +2 Query: 155 LPEPAAAPYRTVS--SRHGADDAVGTVVSMLSGYAGRFSKDAE 277 L +PA++ Y+ S SRHG+++A ++M GRFSK E Sbjct: 87 LEDPASSRYQNFSKGSRHGSEEAYIDPIAMEYYNWGRFSKPPE 129 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,982,941 Number of Sequences: 219361 Number of extensions: 527638 Number of successful extensions: 2143 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2062 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2136 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)