| Clone Name | bastl32a01 |
|---|---|
| Clone Library Name | barley_pub |
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 75.1 bits (183), Expect = 9e-14 Identities = 31/42 (73%), Positives = 37/42 (88%) Frame = +1 Query: 355 ADDENPEDFIDPETPSGQKKSLAPXMAKQYSPSTVEKSWYAW 480 A +ENPEDF+DPETP G++K L+ MAKQYSP+TVEKSWYAW Sbjct: 111 ASEENPEDFVDPETPLGERKRLSSQMAKQYSPATVEKSWYAW 152
>SYV_RAT (Q04462) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1264 Score = 38.1 bits (87), Expect = 0.012 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 385 DPETPSGQKKSLAPXMAKQYSPSTVEKSWYAW 480 D TP G+KK ++ M YSP VE +WY W Sbjct: 281 DLPTPPGEKKDVSGTMPDSYSPQYVEAAWYPW 312
>SYV_MOUSE (Q9Z1Q9) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) (Protein G7a) Length = 1263 Score = 38.1 bits (87), Expect = 0.012 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 385 DPETPSGQKKSLAPXMAKQYSPSTVEKSWYAW 480 D TP G+KK ++ M YSP VE +WY W Sbjct: 280 DLPTPPGEKKDVSGAMPDSYSPQYVEAAWYPW 311
>SYV_FUGRU (P49696) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1217 Score = 38.1 bits (87), Expect = 0.012 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 385 DPETPSGQKKSLAPXMAKQYSPSTVEKSWYAW 480 D TPSG+KK + + YSP VE +WY W Sbjct: 230 DIPTPSGEKKDVVSPLPDSYSPQYVEAAWYPW 261
>SYV_HUMAN (P26640) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) (Protein G7a) Length = 1264 Score = 37.0 bits (84), Expect = 0.027 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = +1 Query: 385 DPETPSGQKKSLAPXMAKQYSPSTVEKSWYAW 480 D TP G+KK ++ M YSP VE +WY W Sbjct: 281 DLPTPPGEKKDVSGPMPDSYSPRYVEAAWYPW 312
>SYV_YEAST (P07806) Valyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 1104 Score = 33.9 bits (76), Expect = 0.23 Identities = 18/38 (47%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = +1 Query: 376 DFIDPETPSGQKK---SLAPXMAKQYSPSTVEKSWYAW 480 +FID P G+KK SL K Y+P+ VE SWY W Sbjct: 124 EFIDKTVP-GEKKILVSLDDPALKAYNPANVESSWYDW 160
>SYV_SCHPO (O75005) Probable valyl-tRNA synthetase, mitochondrial precursor| (EC 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 980 Score = 30.8 bits (68), Expect = 1.9 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 4/39 (10%) Frame = +1 Query: 376 DFIDPETPSGQKKSL----APXMAKQYSPSTVEKSWYAW 480 ++++ TP G+KK L +P + K Y+P VE +WY W Sbjct: 73 EYVEKTTP-GEKKVLQDLDSPAL-KSYNPKAVESAWYDW 109
>SYV_NEUCR (P28350) Valyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 1093 Score = 30.8 bits (68), Expect = 1.9 Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = +1 Query: 385 DPETPSGQKK---SLAPXMAKQYSPSTVEKSWYAW 480 + TP+G+KK S Y+PS VE +WY W Sbjct: 118 EDSTPAGEKKVIQSFEHPHFSAYNPSAVEAAWYQW 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.123 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,021,851 Number of Sequences: 219361 Number of extensions: 385131 Number of successful extensions: 910 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 900 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 910 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)