Clone Name | bastl31g06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 65 | 7e-11 | 2 | VTS1_ASHGO (Q758Y4) Protein VTS1 | 30 | 3.1 | 3 | SYV_FUGRU (P49696) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--t... | 28 | 8.9 |
---|
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 65.5 bits (158), Expect = 7e-11 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +3 Query: 351 ADDENPEDFIDPETPSGRKKSLAPQMAKQYSPSTVGKSW 467 A +ENPEDF+DPETP G +K L+ QMAKQYSP+TV KSW Sbjct: 111 ASEENPEDFVDPETPLGERKRLSSQMAKQYSPATVEKSW 149
>VTS1_ASHGO (Q758Y4) Protein VTS1| Length = 490 Score = 30.0 bits (66), Expect = 3.1 Identities = 16/55 (29%), Positives = 22/55 (40%) Frame = +3 Query: 303 TSDGPXXXXXXXXXXAADDENPEDFIDPETPSGRKKSLAPQMAKQYSPSTVGKSW 467 TS GP ++ + NP+ DP+ L +YS S GKSW Sbjct: 390 TSPGPSTPNAASNVSSSSNMNPKSLCDPKLLKNIPAWLKSLRLHKYSASLNGKSW 444
>SYV_FUGRU (P49696) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1217 Score = 28.5 bits (62), Expect = 8.9 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = +3 Query: 381 DPETPSGRKKSLAPQMAKQYSPSTVGKSW 467 D TPSG KK + + YSP V +W Sbjct: 230 DIPTPSGEKKDVVSPLPDSYSPQYVEAAW 258 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,849,214 Number of Sequences: 219361 Number of extensions: 369684 Number of successful extensions: 1153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1144 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1153 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)