| Clone Name | bastl31f09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DUS15_HUMAN (Q9H1R2) Dual specificity protein phosphatase 15 (EC... | 30 | 2.2 | 2 | LECT_SOLTU (Q9S8M0) Chitin-binding lectin 1 precursor (PL-I) | 29 | 2.9 | 3 | PO121_HUMAN (Q9Y2N3) Nuclear envelope pore membrane protein POM ... | 28 | 4.9 | 4 | Y220_SILPO (Q5LX20) UPF0247 protein SPO0220 | 28 | 6.4 | 5 | MUC1_YEAST (P08640) Mucin-like protein 1 precursor | 28 | 8.4 |
|---|
>DUS15_HUMAN (Q9H1R2) Dual specificity protein phosphatase 15 (EC 3.1.3.48) (EC| 3.1.3.16) Length = 295 Score = 29.6 bits (65), Expect = 2.2 Identities = 19/40 (47%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = +1 Query: 19 LAACVWRLQA--IREARGRPARHCRGQCRLRQSPLVTPPP 132 LAA V L A +REA GR A+ CR R L+ PPP Sbjct: 166 LAARVALLSAALVREATGRTAQRCRLSPRAAAERLLGPPP 205
>LECT_SOLTU (Q9S8M0) Chitin-binding lectin 1 precursor (PL-I)| Length = 323 Score = 29.3 bits (64), Expect = 2.9 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +1 Query: 73 ARHCRGQCRLRQSPLVTPPPSP 138 +++C+ QC+L P PPPSP Sbjct: 140 SKNCQSQCKLPSPPPPPPPPSP 161
>PO121_HUMAN (Q9Y2N3) Nuclear envelope pore membrane protein POM 121 (Pore| membrane protein of 121 kDa) (P145) Length = 1229 Score = 28.5 bits (62), Expect = 4.9 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 10/37 (27%) Frame = -2 Query: 115 VATVEDDTGRGSGAPA----------GLELHVLPAAA 35 +A+V D GRG G PA GL L+++PAAA Sbjct: 17 IASVRDGRGRGCGGPAGAALLGLSLVGLLLYLVPAAA 53
>Y220_SILPO (Q5LX20) UPF0247 protein SPO0220| Length = 156 Score = 28.1 bits (61), Expect = 6.4 Identities = 16/38 (42%), Positives = 18/38 (47%) Frame = -2 Query: 118 RVATVEDDTGRGSGAPAGLELHVLPAAATHTQLERKTK 5 RV VED G GA A L LPA A L+ + K Sbjct: 40 RVVEVEDKKNAGMGAEAALLRKALPAGAVLCTLDERGK 77
>MUC1_YEAST (P08640) Mucin-like protein 1 precursor| Length = 1367 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +3 Query: 75 APLPRPVSSSTVATRHPSSFSFRXXXXXXXXXXXXXXXXSRAP 203 AP+P P SSS + + PSS F S+ P Sbjct: 864 APVPTPSSSSNITSSAPSSIPFSSTTESFSTGTTVTPSSSKYP 906 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,621,917 Number of Sequences: 219361 Number of extensions: 372662 Number of successful extensions: 1614 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1547 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1610 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)