Clone Name | bastl31e10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PAX8_RAT (P51974) Paired box protein Pax-8 | 29 | 3.0 | 2 | SPC98_YEAST (P53540) Spindle pole body component SPC98 | 27 | 8.9 | 3 | Y066_NPVLD (P30325) Hypothetical protein in POL 5'region (Fragment) | 27 | 8.9 |
---|
>PAX8_RAT (P51974) Paired box protein Pax-8| Length = 458 Score = 28.9 bits (63), Expect = 3.0 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -3 Query: 276 PAVASDPAPPQRILRQPFLDLVMVGSGGSLAPHLP 172 P ++S + P + FLDL VGSGG +P Sbjct: 314 PELSSSSSTPSSLSSSAFLDLQQVGSGGPAGASVP 348
>SPC98_YEAST (P53540) Spindle pole body component SPC98| Length = 846 Score = 27.3 bits (59), Expect = 8.9 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 238 LEAAVLGLGHGRIGW 194 L+A VL LGHG +GW Sbjct: 541 LDARVLDLGHGSVGW 555
>Y066_NPVLD (P30325) Hypothetical protein in POL 5'region (Fragment)| Length = 369 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 291 VSGSEPAVASDPAPPQRILRQPFLDLVMVGSGGSLA 184 ++ SEP AS P+PP+ P V + S G A Sbjct: 120 IAPSEPTPASAPSPPKADAPNPIQQNVYINSAGEAA 155 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,468,326 Number of Sequences: 219361 Number of extensions: 355424 Number of successful extensions: 1177 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1177 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)