>MYCB2_MOUSE (Q7TPH6) Probable ubiquitin ligase protein MYCBP2 (EC 6.3.2.-) (Myc|
            binding protein 2) (Protein associated with Myc)
            (Pam/highwire/rpm-1 protein)
          Length = 4711

 Score = 28.5 bits (62), Expect = 5.3
 Identities = 12/31 (38%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = -2

Query: 111  SGLRLPIRDPGEGVWPAGYSLLS-RPDPDPN 22
            +GL + ++DP +G+ P G  L+  + DP PN
Sbjct: 2393 AGLEVKVKDPPKGMIPPGTQLVKPKADPQPN 2423


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 16,346,868
Number of Sequences: 219361
Number of extensions: 210549
Number of successful extensions: 609
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 604
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 609
length of database: 80,573,946
effective HSP length: 25
effective length of database: 75,089,921
effective search space used: 1802158104
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)