| Clone Name | bastl31c11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MATK_CAPHA (Q5VH41) Maturase K (Intron maturase) | 30 | 2.6 | 2 | AN3_XENLA (P24346) Putative ATP-dependent RNA helicase an3 (EC 3... | 30 | 4.4 | 3 | MURD_BACSU (Q03522) UDP-N-acetylmuramoylalanine--D-glutamate lig... | 29 | 7.5 | 4 | IMB2_SCHPO (O14089) Putative importin beta-2 subunit (Karyopheri... | 28 | 9.7 |
|---|
>MATK_CAPHA (Q5VH41) Maturase K (Intron maturase)| Length = 504 Score = 30.4 bits (67), Expect = 2.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 320 YLNFDHPMNHLFFHPFFVNEVVYIV 246 YL FD H F +PFF E +Y++ Sbjct: 7 YLEFDGARQHNFLYPFFFRESIYVL 31
>AN3_XENLA (P24346) Putative ATP-dependent RNA helicase an3 (EC 3.6.1.-)| Length = 697 Score = 29.6 bits (65), Expect = 4.4 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 209 NKTDSQSR-ASCHGRYKPPHLRKKDGKTN 292 N D++S A GRY PPHLR K+ N Sbjct: 22 NSADAESGVAGTKGRYIPPHLRNKEASRN 50
>MURD_BACSU (Q03522) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 451 Score = 28.9 bits (63), Expect = 7.5 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%) Frame = -1 Query: 234 ALDCESVLFSFGVI-ADGEDDLSPYTKNICKFATKPATCPESEAFGSE 94 A D +L + G+ +G DDL PY K++ T T P+ E G+E Sbjct: 345 AFDKPVILLAGGLDRGNGFDDLKPYMKHVKAVLTFGQTAPKLEKLGNE 392
>IMB2_SCHPO (O14089) Putative importin beta-2 subunit (Karyopherin beta-2| subunit) (Importin 104) (Transportin) (TRN) Length = 910 Score = 28.5 bits (62), Expect = 9.7 Identities = 10/29 (34%), Positives = 19/29 (65%) Frame = +3 Query: 57 FILPFFVVCISFFQNQKLHFQDM*QVLWQ 143 ++LP FV+C++ ++N +DM Q + Q Sbjct: 854 YLLPMFVLCVAEYENPSAELRDMFQKILQ 882 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,436,337 Number of Sequences: 219361 Number of extensions: 1067130 Number of successful extensions: 3355 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3355 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)