Clone Name | bastl31c08 |
---|---|
Clone Library Name | barley_pub |
>PRG4_MOUSE (Q9JM99) Proteoglycan-4 precursor (Lubricin) (Megakaryocyte| stimulating factor) (Superficial zone proteoglycan) [Contains: Proteoglycan-4 C-terminal part] Length = 1054 Score = 32.7 bits (73), Expect = 0.42 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = +2 Query: 8 KPTHSPRNSQAHKNSEK*KSSRKIGVPNPLPRASRIPRIPTNPHEIFQPS 157 KPT +P+ + K + K+ + P+PL S P + T P E+ P+ Sbjct: 676 KPTKAPKKPTSTKKPKTPKTRKPKTTPSPLKTTSATPELNTTPLEVMLPT 725
>B3A2_RABIT (P48746) Anion exchange protein 2 (Non-erythroid band 3-like| protein) (AE2 anion exchanger) (Solute carrier family 4 member 2) (B3RP) Length = 1237 Score = 31.2 bits (69), Expect = 1.2 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +2 Query: 62 KSSRKIGVPNPLPRASRIPRIPTNPHEIFQPSNAAAFRRFPDEAHREIQR 211 +SSR+ P P PR+ PR P PHE+F N + + RE R Sbjct: 294 QSSREGREPGPTPRSR--PRAPHKPHEVFVELNELLLDKNQEPQWRETAR 341
>B3A2_CAVPO (Q9Z0S8) Anion exchange protein 2 (Non-erythroid band 3-like| protein) (AE2 anion exchanger) (Solute carrier family 4 member 2) Length = 1238 Score = 30.8 bits (68), Expect = 1.6 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = +2 Query: 62 KSSRKIGVPNPLPRASRIPRIPTNPHEIFQPSNAAAFRRFPDEAHREIQR 211 +SSR+ P P PR PR P PHE+F N + + RE R Sbjct: 294 QSSREGREPGPTPRTR--PRAPHKPHEVFVELNELLLDKNQEPQWRETAR 341
>B3A2_HUMAN (P04920) Anion exchange protein 2 (Non-erythroid band 3-like| protein) (AE2 anion exchanger) (Solute carrier family 4 member 2) (BND3L) Length = 1241 Score = 30.8 bits (68), Expect = 1.6 Identities = 18/50 (36%), Positives = 23/50 (46%) Frame = +2 Query: 62 KSSRKIGVPNPLPRASRIPRIPTNPHEIFQPSNAAAFRRFPDEAHREIQR 211 +S R+ P P PRA PR P PHE+F N + + RE R Sbjct: 298 QSGREGREPGPTPRAR--PRAPHKPHEVFVELNELLLDKNQEPQWRETAR 345
>B3A2_RAT (P23347) Anion exchange protein 2 (Non-erythroid band 3-like| protein) (AE2 anion exchanger) (Solute carrier family 4 member 2) (B3RP) Length = 1234 Score = 30.0 bits (66), Expect = 2.7 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +2 Query: 62 KSSRKIGVPNPLPRASRIPRIPTNPHEIFQPSNAAAFRRFPDEAHREIQR 211 +++R+ P P PRA PR P PHE+F N + + RE R Sbjct: 295 QAAREGREPGPTPRAR--PRAPHKPHEVFVELNELQLDKNQEPQWRETAR 342
>B3A2_MOUSE (P13808) Anion exchange protein 2 (Non-erythroid band 3-like| protein) (AE2 anion exchanger) (Solute carrier family 4 member 2) (B3RP) Length = 1237 Score = 30.0 bits (66), Expect = 2.7 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = +2 Query: 62 KSSRKIGVPNPLPRASRIPRIPTNPHEIFQPSNAAAFRRFPDEAHREIQR 211 +++R+ P P PRA PR P PHE+F N + + RE R Sbjct: 294 QAAREGREPGPTPRAR--PRAPHKPHEVFVELNELLLDKNQEPQWRETAR 341
>FABH_GLOVI (Q7NF35) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 329 Score = 28.9 bits (63), Expect = 6.0 Identities = 22/88 (25%), Positives = 34/88 (38%), Gaps = 9/88 (10%) Frame = -1 Query: 369 IKRTAQGAKIAPLLPYSYRSHAAATQLIDQDAAARDGAPRR---------TTSESATTLC 217 I++T +AP +Y H A +++D A+ AP R TS ++ L Sbjct: 233 IEKTLAACGVAPEQVKAYLLHQANQRILDSVASRLHVAPERMASNLADYGNTSSASVPLI 292 Query: 216 TARWISRWASSGNLRKAAALEGWKISWG 133 W+ R A G +SWG Sbjct: 293 LQEWVQDGRIRAGDRVVLAGFGAGLSWG 320
>M3K4_HUMAN (Q9Y6R4) Mitogen-activated protein kinase kinase kinase 4 (EC| 2.7.11.25) (MAPK/ERK kinase kinase 4) (MEK kinase 4) (MEKK 4) (MAP three kinase 1) Length = 1607 Score = 28.9 bits (63), Expect = 6.0 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 3/59 (5%) Frame = +2 Query: 98 PRASRIPRI---PTNPHEIFQPSNAAAFRRFPDEAHREIQRAVHRVVADSLVVRRGAPS 265 PR ++PR P NPH I + R P +A A A ++ R +PS Sbjct: 1149 PRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAVAASRPSPS 1207
>BLNK_HUMAN (Q8WV28) B-cell linker protein (Cytoplasmic adapter protein)| (B-cell adapter containing SH2 domain protein) (B-cell adapter containing Src homology 2 domain protein) (Src homology 2 domain-containing leukocyte protein of 65 kDa) (SLP-65) Length = 456 Score = 28.9 bits (63), Expect = 6.0 Identities = 21/65 (32%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = +2 Query: 14 THSPRNSQAHKNSEK*KSSRKIGVPNPLPRASRIPRIPTNPHEIFQPSNAAAF---RRFP 184 T S RNS A + S P+PLPRA + P P + NA++ + P Sbjct: 223 TASGRNSGAWETK-----SPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIP 277 Query: 185 DEAHR 199 E HR Sbjct: 278 AERHR 282
>RNB_HHV1M (P56958) RNA-binding protein (Vmw21)| Length = 161 Score = 28.9 bits (63), Expect = 6.0 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +2 Query: 8 KPTHSPRNSQAHKNSEK*KSSRKIGVPNPLPRASRIPRIPTNPHEIFQP 154 +P PR + + + R+ P +PRASR PR+P +P + QP Sbjct: 80 RPPTIPRTPRVPREPRVPRPPREPREPR-VPRASRDPRVPRDPRDPRQP 127 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,370,737 Number of Sequences: 219361 Number of extensions: 1088625 Number of successful extensions: 3483 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3329 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3470 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)