Clone Name | bastl31b05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SUBL_ARATH (O65351) Subtilisin-like protease precursor (EC 3.4.2... | 46 | 6e-05 |
---|
>SUBL_ARATH (O65351) Subtilisin-like protease precursor (EC 3.4.21.-)| (Cucumisin-like serine protease) Length = 757 Score = 45.8 bits (107), Expect = 6e-05 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = +1 Query: 385 TEQRATYIVHMAKSAMPAEYADHGEWYGASLRSVS 489 + + TYIVHMAKS MP+ + H WY +SLRS+S Sbjct: 26 SSDQGTYIVHMAKSQMPSSFDLHSNWYDSSLRSIS 60 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,384,663 Number of Sequences: 219361 Number of extensions: 1072052 Number of successful extensions: 3457 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3451 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)