Clone Name | bastl30h12 |
---|---|
Clone Library Name | barley_pub |
>DNJBC_MOUSE (Q9QYI4) DnaJ homolog subfamily B member 12 (mDJ10)| Length = 376 Score = 29.6 bits (65), Expect = 1.8 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 225 MECNREEASRAREIAVKKLENKDFVGARKIALKAQILFP 341 ME N++EA R IA+K +++ A + KAQ L+P Sbjct: 1 MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYP 39
>DNJBC_HUMAN (Q9NXW2) DnaJ homolog subfamily B member 12| Length = 375 Score = 29.3 bits (64), Expect = 2.4 Identities = 15/39 (38%), Positives = 23/39 (58%) Frame = +3 Query: 225 MECNREEASRAREIAVKKLENKDFVGARKIALKAQILFP 341 ME N++EA R IA+K +++ A + KAQ L+P Sbjct: 1 MESNKDEAERCISIALKAIQSNQPDRALRFLEKAQRLYP 39
>SYV_PYRAE (Q8ZVG2) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 799 Score = 28.1 bits (61), Expect = 5.3 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = -3 Query: 353 ILKLWK*DLSFKCNLSGTNEVFIFQ----LLYSNFPGSGSLFSVA 231 +LKLW+ + FK +SG+ VF+ L SN P G S A Sbjct: 17 LLKLWEKEGRFKTKISGSRPVFVIDTPPPYLSSNRPHIGQTASYA 61
>YDDK_ECOLI (P76123) Hypothetical protein yddK| Length = 318 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 210 KNTTKLSREVISAGNEYPLTQASQQITDAHIW 115 KNTTKL +S N P Q I+ H+W Sbjct: 29 KNTTKLEYLNLSNNNLLPTNDIDQLISSKHLW 60
>MPAA2_AMBAR (P27762) Pollen allergen Amb a 2 precursor (Antigen K) (Antigen Amb| a II) Length = 397 Score = 27.7 bits (60), Expect = 6.9 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +3 Query: 126 HPLSAVKLESEDTHFQLISLHVRVLWYFLSVTMME 230 H AV L + DTHFQ + +HV + + + T+ E Sbjct: 239 HHEKAVLLGASDTHFQDLKMHVTLAYNIFTNTVHE 273
>YAM5_SCHPO (Q10060) Hypothetical protein C1F5.05c in chromosome I| Length = 151 Score = 27.3 bits (59), Expect = 9.0 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +2 Query: 17 PRRLAGACSSAATPPFLVLMQ*IFSHSVFEKLIQMCASV 133 PRRL+ + SSA++PP L HS F+ L + S+ Sbjct: 85 PRRLSSSTSSASSPPLRRLPS--VQHSTFDDLFEGVGSL 121 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,024,760 Number of Sequences: 219361 Number of extensions: 918471 Number of successful extensions: 2352 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2305 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2351 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 1370455656 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)