Clone Name | bastl30h11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CAC1G_HUMAN (O43497) Voltage-dependent T-type calcium channel al... | 30 | 2.6 | 2 | SP3_MOUSE (O70494) Transcription factor Sp3 | 29 | 5.8 | 3 | ALA1_CANAL (O13368) Agglutinin-like protein ALA1 precursor (Aggl... | 29 | 5.8 | 4 | IL7RA_MOUSE (P16872) Interleukin-7 receptor alpha chain precurso... | 28 | 9.9 |
---|
>CAC1G_HUMAN (O43497) Voltage-dependent T-type calcium channel alpha-1G subunit| (Voltage-gated calcium channel alpha subunit Cav3.1) (Cav3.1c) (NBR13) Length = 2377 Score = 30.0 bits (66), Expect = 2.6 Identities = 19/57 (33%), Positives = 26/57 (45%), Gaps = 6/57 (10%) Frame = -1 Query: 425 PP*RNESLENXAE-GSSSSMAHPPALRNRTHSP-----AWQSARLSPETATRGPETR 273 P R S AE G++ M PP+ R+ HSP +W S R S + R P + Sbjct: 1064 PASRRTSSSGSAEPGAAHEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLK 1120
>SP3_MOUSE (O70494) Transcription factor Sp3| Length = 783 Score = 28.9 bits (63), Expect = 5.8 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 339 AFTCVAVGPPQPGDGDARA 283 A TC +GPP PGD D A Sbjct: 62 AATCSKIGPPSPGDDDEEA 80
>ALA1_CANAL (O13368) Agglutinin-like protein ALA1 precursor (Agglutinin-like| adhesin) Length = 1419 Score = 28.9 bits (63), Expect = 5.8 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = -1 Query: 410 ESLENXAEGSSSSMAHPPALRNRTHSPAWQSARLSPETATRGPE 279 E++ N EG+ S + P T + W + + ET T GPE Sbjct: 560 ETITNKPEGTDSVIVKEPYNPTVTTTEFWSESYATTETITNGPE 603
>IL7RA_MOUSE (P16872) Interleukin-7 receptor alpha chain precursor (IL-7R-alpha)| (CD127 antigen) Length = 459 Score = 28.1 bits (61), Expect = 9.9 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 368 AHPPALRNRTHSPAWQSARLSPETATRGPET 276 A P L + H A SA SPET+ PET Sbjct: 330 AQPEELETQGHRAAVHSANRSPETSVSPPET 360 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.136 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,562,819 Number of Sequences: 219361 Number of extensions: 455857 Number of successful extensions: 1538 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1538 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)