| Clone Name | bastl30f08 |
|---|---|
| Clone Library Name | barley_pub |
>CAND2_HUMAN (O75155) Cullin-associated NEDD8-dissociated protein 2| (Cullin-associated and neddylation-dissociated protein 2) (p120 CAND2) Length = 1119 Score = 29.6 bits (65), Expect = 1.8 Identities = 17/36 (47%), Positives = 20/36 (55%) Frame = +2 Query: 38 PYGEFHASLLRILEPQIRAPPLPSDGSRCRRRRLVG 145 P G FHASLL L PQ+ +P L R+R VG Sbjct: 75 PLGAFHASLLHCLLPQLSSPRL------AVRKRAVG 104
>CAND2_MOUSE (Q6ZQ73) Cullin-associated NEDD8-dissociated protein 2| (Cullin-associated and neddylation-dissociated protein 2) (p120 CAND2) (TBP-interacting protein TIP120B) (TBP-interacting protein of 120 kDa B) Length = 1235 Score = 29.3 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 38 PYGEFHASLLRILEPQIRAPPL 103 P G FHASLL L PQ+ +P L Sbjct: 168 PLGTFHASLLHCLLPQLSSPRL 189
>CAND2_RAT (Q9R0L4) Cullin-associated NEDD8-dissociated protein 2| (Cullin-associated and neddylation-dissociated protein 2) (p120 CAND2) (TBP-interacting protein TIP120B) (TBP-interacting protein of 120 kDa B) (TBP-interacting protein b) Length = 1273 Score = 29.3 bits (64), Expect = 2.3 Identities = 13/22 (59%), Positives = 15/22 (68%) Frame = +2 Query: 38 PYGEFHASLLRILEPQIRAPPL 103 P G FHASLL L PQ+ +P L Sbjct: 206 PLGTFHASLLHCLLPQLSSPRL 227
>RSP6_CAEEL (Q18409) Probable splicing factor, arginine/serine-rich 6| (RNA-binding protein srp-1) (CeSRp20) Length = 179 Score = 28.9 bits (63), Expect = 3.1 Identities = 17/43 (39%), Positives = 19/43 (44%) Frame = -1 Query: 129 RRQRDPSEGRGGARICGSRIRRSEAWNSP*GLGGREPGFESRG 1 R D G+RICG R R + G GGR GF RG Sbjct: 50 RDAEDAVRALDGSRICGVRARVELSTGQRRGGGGRGGGFGGRG 92
>PPB_ESCFE (P21948) Alkaline phosphatase precursor (EC 3.1.3.1) (APase)| Length = 472 Score = 28.1 bits (61), Expect = 5.2 Identities = 19/63 (30%), Positives = 27/63 (42%), Gaps = 8/63 (12%) Frame = -3 Query: 175 TVRRCHASSVSHEPAPAAAGSIGGEG--------RRSDLRLQDPEERGMEFPVGFGWEGT 20 T R+C+ SV+ E P A GG+G R+D+ L + E W+G Sbjct: 187 TSRKCYGPSVTSEKCPGNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAGEWQGK 246 Query: 19 WLR 11 LR Sbjct: 247 TLR 249
>IF2_CHRVO (Q7NY13) Translation initiation factor IF-2| Length = 964 Score = 28.1 bits (61), Expect = 5.2 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 157 ASSVSHEPAPAAAGSIGGEGRRSDLRLQDPEERG 56 A++ S PAPA GS G+G++ R D ++G Sbjct: 307 AAAPSQPPAPAPGGSRPGKGKKGGERSWDDNKKG 340
>SI1L3_HUMAN (O60292) Signal-induced proliferation-associated 1-like protein 3| (SPA-1-like protein 3) Length = 1781 Score = 28.1 bits (61), Expect = 5.2 Identities = 17/49 (34%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = -1 Query: 144 PTSRRRRQRD-PSEGRGGARICGSRIRRSEAWNSP*GLGGREPGFESRG 1 PT + + R P+ G GG S I R + P G GR PG G Sbjct: 276 PTKEKEKARKKPARGLGGGDTVDSSIFRKLRSSKPEGEAGRSPGEADEG 324
>UL34_HCMVA (P16812) Hypothetical protein UL34| Length = 407 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = +2 Query: 17 PGSLPPKPYGEFHASLLRILEPQIRAPPLPSD 112 P L P + AS+ L+P +R PP P+D Sbjct: 88 PAELDPHEIQQVTASIRCRLQPSLREPPTPAD 119
>PP16A_MOUSE (Q923M0) Protein phosphatase 1 regulatory subunit 16A (Myosin| phosphatase targeting subunit 3) Length = 524 Score = 27.3 bits (59), Expect = 8.9 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = -3 Query: 184 RMSTVRRCHASS--VSHEPAPAAAGSIGGEGRRSD--LRLQDPEERGME 50 R + R+ HA V +P P + + E R++D LRLQ PE+ G E Sbjct: 357 RTNLYRKEHAQEAIVWQQPPPTSPEPLEDEDRQTDAELRLQPPEDDGPE 405
>ESR1_HUMAN (P03372) Estrogen receptor (ER) (Estradiol receptor) (ER-alpha)| Length = 595 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 135 RRRRQRDPSEGRGGARICGSRIRRSEAWNSP 43 + +RQRD EGRG G +R + W SP Sbjct: 266 KHKRQRDDGEGRGEVGSAGD-MRAANLWPSP 295
>4CL2_ORYSA (Q42982) 4-coumarate--CoA ligase 2 (EC 6.2.1.12) (4CL 2)| (4-coumaroyl-CoA synthase 2) Length = 569 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -3 Query: 139 EPAPAAAGSIGGEGRRSDLRLQDPE 65 EP PA +GS G R ++L++ DP+ Sbjct: 381 EPTPAKSGSCGTVVRNAELKVVDPD 405 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,487,243 Number of Sequences: 219361 Number of extensions: 634788 Number of successful extensions: 2175 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2077 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2173 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)