Clone Name | bastl30e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ICP4_GAHVG (Q02362) Trans-acting transcriptional activator prote... | 30 | 1.1 | 2 | RPOB_MARPO (P06272) DNA-directed RNA polymerase beta chain (EC 2... | 28 | 7.3 |
---|
>ICP4_GAHVG (Q02362) Trans-acting transcriptional activator protein ICP4| (Immediate-early protein IE175) Length = 1415 Score = 30.4 bits (67), Expect = 1.1 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 350 SIYQTSPLPPPGRCW 306 S++ PLPPPGRCW Sbjct: 284 SVWWEVPLPPPGRCW 298
>RPOB_MARPO (P06272) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (PEP)| (Plastid-encoded RNA polymerase beta subunit) (RNA polymerase beta subunit) Length = 1065 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 235 LRAQAGRLWFRCAATTLATVQRVCQHLPGGGRGEV 339 LRA G+L +AT + C +P GGRG V Sbjct: 746 LRAPEGKLLQAIFGIQVATSKETCLKVPPGGRGRV 780 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,996,591 Number of Sequences: 219361 Number of extensions: 351105 Number of successful extensions: 1081 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1072 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1081 length of database: 80,573,946 effective HSP length: 92 effective length of database: 60,392,734 effective search space used: 1449425616 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)