Clone Name | bastl30d07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CBIO1_TREDE (Q73R11) Putative cobalt import ATP-binding protein ... | 32 | 0.71 | 2 | PAIR1_ORYSA (Q75RY2) Protein PAIR1 (HOMOLOGOUS PAIRING ABERRATIO... | 29 | 7.8 | 3 | TRPA1_CAEEL (Q18297) Transient receptor potential cation channel... | 29 | 7.8 |
---|
>CBIO1_TREDE (Q73R11) Putative cobalt import ATP-binding protein cbiO 1| Length = 489 Score = 32.3 bits (72), Expect = 0.71 Identities = 17/50 (34%), Positives = 26/50 (52%) Frame = +2 Query: 251 QVSEDVKTTFQNPASSVQNNVMQLKAVTGEDEGGTPIRDLVAVVQLVTRD 400 Q+S+ V T FQNP + N + V G + G P L++ ++ VT D Sbjct: 79 QLSDSVGTVFQNPRTQFFNTDTDSEIVFGLENRGLPPEQLLSRLEKVTED 128
>PAIR1_ORYSA (Q75RY2) Protein PAIR1 (HOMOLOGOUS PAIRING ABERRATION IN RICE| MEIOSIS 1 protein) Length = 492 Score = 28.9 bits (63), Expect = 7.8 Identities = 26/62 (41%), Positives = 34/62 (54%), Gaps = 14/62 (22%) Frame = +2 Query: 242 RSGQVS-EDVKTTFQNPAS----------SVQNNVMQLKAVTGE---DEGGTPIRDLVAV 379 RSGQV+ EDV+ FQ+ AS SVQ++VMQL E D G IR +AV Sbjct: 139 RSGQVTNEDVERKFQHLASSVHKMGMVVDSVQSDVMQLNRAMKEASLDSGS--IRQKIAV 196 Query: 380 VQ 385 ++ Sbjct: 197 LE 198
>TRPA1_CAEEL (Q18297) Transient receptor potential cation channel subfamily A| member 1 homolog Length = 1193 Score = 28.9 bits (63), Expect = 7.8 Identities = 24/70 (34%), Positives = 31/70 (44%) Frame = +2 Query: 215 SRVDAPTRGRSGQVSEDVKTTFQNPASSVQNNVMQLKAVTGEDEGGTPIRDLVAVVQLVT 394 S + +PTR VSEDV+ T N QN M + A G E ++ A + V Sbjct: 427 SALKSPTRNTLRIVSEDVRRTMVNMVDRDQNTPMHIVASNGYLEMMQLLQKHGASITQVN 486 Query: 395 RDACASETAL 424 D ETAL Sbjct: 487 ED---EETAL 493 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,968,172 Number of Sequences: 219361 Number of extensions: 918904 Number of successful extensions: 2711 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2637 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2711 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)