Clone Name | bastl30d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | DAP2_YEAST (P18962) Dipeptidyl aminopeptidase B (EC 3.4.14.-) (D... | 30 | 2.8 | 2 | CUBN_RAT (O70244) Cubilin precursor (Intrinsic factor-cobalamin ... | 29 | 8.1 |
---|
>DAP2_YEAST (P18962) Dipeptidyl aminopeptidase B (EC 3.4.14.-) (DPAP B) (YSCV)| Length = 818 Score = 30.4 bits (67), Expect = 2.8 Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 6/68 (8%) Frame = +1 Query: 268 KGFHHLPRSFVAALGLEDYLLP--SFNCCSLA----GDCILLKSFELLIKSPRNTGFDAT 429 K +HL ++ V LEDY +P SF +L G IL+ S+E+L FD T Sbjct: 530 KSLYHLEKNEVLTKILEDYAVPRKSFRELNLGKDEFGKDILVNSYEIL-----PNDFDET 584 Query: 430 **GHYAVF 453 HY VF Sbjct: 585 LSDHYPVF 592
>CUBN_RAT (O70244) Cubilin precursor (Intrinsic factor-cobalamin receptor)| (Intrinsic factor-vitamin B12 receptor) (Glycoprotein 280) (gp280) (460 kDa receptor) Length = 3623 Score = 28.9 bits (63), Expect = 8.1 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 13/60 (21%) Frame = +1 Query: 205 PGPLKLGGQ-----FRSITQLAAGG--------CKGFHHLPRSFVAALGLEDYLLPSFNC 345 PGP++ G+ F S T +A G C G+ H R + + D LP+ NC Sbjct: 2059 PGPIRSTGEYMYIRFTSDTSVAGTGFNASFHKSCGGYLHADRGVITSPKYPDTYLPNLNC 2118 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,024,949 Number of Sequences: 219361 Number of extensions: 821982 Number of successful extensions: 1679 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1679 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)