>RPOA_PRRSR (Q9WJB2) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:|
            Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1-alpha
            papain-like cysteine proteinase (EC 3.4.22.-)
            (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase
            (EC 3.4.22.-) (PCP
          Length = 3960

 Score = 29.3 bits (64), Expect = 5.5
 Identities = 21/55 (38%), Positives = 27/55 (49%)
 Frame = +1

Query: 307  TNAVGAAMDFSQPSCRPWERGDLLHRLATFKPSTWASNQRLLVHWPVLXGLGDIG 471
            ++ VGAA +F  P CR     ++LH     KP  W    R LV  PV  GL  +G
Sbjct: 1313 SDPVGAACEFDSPECR-----NILHSFELLKP--W-DPVRSLVVGPVGLGLAILG 1359


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.316    0.130    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 56,170,344
Number of Sequences: 219361
Number of extensions: 880339
Number of successful extensions: 2340
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2281
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2340
length of database: 80,573,946
effective HSP length: 103
effective length of database: 57,979,763
effective search space used: 3188886965
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)