Clone Name | bastl30b08 |
---|---|
Clone Library Name | barley_pub |
>SYV_ARATH (P93736) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1108 Score = 81.6 bits (200), Expect = 1e-15 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = +1 Query: 355 ADDENPEDFIDPETPSGQKKSLAPXMAKQYSPSTVEKSWYAWWESA 492 A +ENPEDF+DPETP G++K L+ MAKQYSP+TVEKSWYAWWE + Sbjct: 111 ASEENPEDFVDPETPLGERKRLSSQMAKQYSPATVEKSWYAWWEKS 156
>SYV_FUGRU (P49696) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1217 Score = 47.4 bits (111), Expect = 2e-05 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 385 DPETPSGQKKSLAPXMAKQYSPSTVEKSWYAWWESAGY 498 D TPSG+KK + + YSP VE +WY WWE G+ Sbjct: 230 DIPTPSGEKKDVVSPLPDSYSPQYVEAAWYPWWEKQGF 267
>SYV_RAT (Q04462) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 1264 Score = 47.0 bits (110), Expect = 3e-05 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 385 DPETPSGQKKSLAPXMAKQYSPSTVEKSWYAWWESAGY 498 D TP G+KK ++ M YSP VE +WY WWE G+ Sbjct: 281 DLPTPPGEKKDVSGTMPDSYSPQYVEAAWYPWWERQGF 318
>SYV_MOUSE (Q9Z1Q9) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) (Protein G7a) Length = 1263 Score = 47.0 bits (110), Expect = 3e-05 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 385 DPETPSGQKKSLAPXMAKQYSPSTVEKSWYAWWESAGY 498 D TP G+KK ++ M YSP VE +WY WWE G+ Sbjct: 280 DLPTPPGEKKDVSGAMPDSYSPQYVEAAWYPWWERQGF 317
>SYV_HUMAN (P26640) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) (Protein G7a) Length = 1264 Score = 46.2 bits (108), Expect = 5e-05 Identities = 18/38 (47%), Positives = 23/38 (60%) Frame = +1 Query: 385 DPETPSGQKKSLAPXMAKQYSPSTVEKSWYAWWESAGY 498 D TP G+KK ++ M YSP VE +WY WWE G+ Sbjct: 281 DLPTPPGEKKDVSGPMPDSYSPRYVEAAWYPWWEQQGF 318
>SYV_NEUCR (P28350) Valyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 1093 Score = 43.5 bits (101), Expect = 3e-04 Identities = 19/41 (46%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Frame = +1 Query: 385 DPETPSGQKK---SLAPXMAKQYSPSTVEKSWYAWWESAGY 498 + TP+G+KK S Y+PS VE +WY WWE AGY Sbjct: 118 EDSTPAGEKKVIQSFEHPHFSAYNPSAVEAAWYQWWEKAGY 158
>SYV_YEAST (P07806) Valyl-tRNA synthetase, mitochondrial precursor (EC| 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 1104 Score = 39.3 bits (90), Expect = 0.006 Identities = 20/43 (46%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = +1 Query: 376 DFIDPETPSGQKK---SLAPXMAKQYSPSTVEKSWYAWWESAG 495 +FID P G+KK SL K Y+P+ VE SWY WW G Sbjct: 124 EFIDKTVP-GEKKILVSLDDPALKAYNPANVESSWYDWWIKTG 165
>SYV_THIDA (Q3SL86) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 912 Score = 38.9 bits (89), Expect = 0.008 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +AK + P+ +EK WYA WESAGY Sbjct: 3 LAKSFEPAEIEKRWYARWESAGY 25
>SYV_SCHPO (O75005) Probable valyl-tRNA synthetase, mitochondrial precursor| (EC 6.1.1.9) (Valine--tRNA ligase) (ValRS) Length = 980 Score = 38.1 bits (87), Expect = 0.013 Identities = 17/45 (37%), Positives = 28/45 (62%), Gaps = 4/45 (8%) Frame = +1 Query: 376 DFIDPETPSGQKKSL----APXMAKQYSPSTVEKSWYAWWESAGY 498 ++++ TP G+KK L +P + K Y+P VE +WY WW +G+ Sbjct: 73 EYVEKTTP-GEKKVLQDLDSPAL-KSYNPKAVESAWYDWWVKSGF 115
>SYV_DEHE1 (Q3Z9C5) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 880 Score = 35.0 bits (79), Expect = 0.11 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +1 Query: 424 PXMAKQYSPSTVEKSWYAWWESAGY 498 P MAK Y + VEK WY +W GY Sbjct: 8 PEMAKAYEAAEVEKKWYQYWMEKGY 32
>SYV_CHRVO (Q7NUM8) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 939 Score = 35.0 bits (79), Expect = 0.11 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +AK Y P +E+ WY WE AGY Sbjct: 4 LAKSYEPGDLERRWYQHWEQAGY 26
>SYV_GEOSL (Q74BJ6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 887 Score = 34.7 bits (78), Expect = 0.14 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +AK Y P+ VE+ WY WE GY Sbjct: 6 LAKVYEPTAVERKWYETWEQEGY 28
>SYV_NITEU (Q82X51) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 918 Score = 34.3 bits (77), Expect = 0.19 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +AK + P +E WY+ WE+AGY Sbjct: 3 LAKSFDPKEIETRWYSTWETAGY 25
>SYV_DEHSC (Q3ZZG9) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 880 Score = 32.7 bits (73), Expect = 0.55 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +1 Query: 424 PXMAKQYSPSTVEKSWYAWWESAGY 498 P MAK Y + VEK WY +W Y Sbjct: 8 PEMAKAYEAAEVEKKWYQYWMEKSY 32
>SYV_THEMA (Q9X2D7) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 865 Score = 32.3 bits (72), Expect = 0.72 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 ++ +Y+P+ +E WY +WE GY Sbjct: 4 LSTRYNPAEIETKWYRYWEEKGY 26
>SYV_PSEU2 (Q4ZXI0) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 948 Score = 32.3 bits (72), Expect = 0.72 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y P +E SWY WES Y Sbjct: 1 MDKTYQPHAIETSWYQTWESENY 23
>SYV_PSESM (Q887M3) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 948 Score = 32.3 bits (72), Expect = 0.72 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y P +E SWY WES Y Sbjct: 1 MDKTYQPHAIETSWYQTWESENY 23
>SYV_PSEF5 (Q4KHT9) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 948 Score = 32.3 bits (72), Expect = 0.72 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y P +E SWY WES Y Sbjct: 1 MDKTYQPHAIETSWYQTWESENY 23
>SYV_PSE14 (Q48MF2) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 948 Score = 32.3 bits (72), Expect = 0.72 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y P +E SWY WES Y Sbjct: 1 MDKTYQPHAIETSWYQTWESENY 23
>SYV_NITOC (Q3JC50) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 929 Score = 32.3 bits (72), Expect = 0.72 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y+P +E+ WY WE GY Sbjct: 1 MDKNYNPQAIEQYWYQIWEQKGY 23
>SYV_PSEPK (Q88P76) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 948 Score = 32.0 bits (71), Expect = 0.94 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y P +E SWY WES Y Sbjct: 1 MDKTYQPHAIETSWYNTWESENY 23
>SYV_ACIAD (Q6F8F0) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 971 Score = 32.0 bits (71), Expect = 0.94 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +1 Query: 421 APXMAKQYSPSTVEKSWYAWWESAGY 498 A +A Y P+ +E+ WY WE GY Sbjct: 13 AQNIATTYDPTDIERKWYQIWEEKGY 38
>SYV_CARHZ (Q3AF87) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 878 Score = 31.6 bits (70), Expect = 1.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 442 YSPSTVEKSWYAWWESAGY 498 YSP VE+ WY +WE G+ Sbjct: 9 YSPQEVERKWYKYWEENGF 27
>SYV_YERPS (Q66F11) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 965 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 394 TPSGQKKSLAPXMAKQYSPSTVEKSWYAWWESAGY 498 TPS K+ P + K YSP +E+ Y WE GY Sbjct: 4 TPSHINKT-EPSLDKTYSPQEIEQPLYEHWEKQGY 37
>SYV_YERPE (Q8ZBH1) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 965 Score = 31.6 bits (70), Expect = 1.2 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = +1 Query: 394 TPSGQKKSLAPXMAKQYSPSTVEKSWYAWWESAGY 498 TPS K+ P + K YSP +E+ Y WE GY Sbjct: 4 TPSHINKT-EPSLDKTYSPQEIEQPLYEHWEKQGY 37
>SYV_PSEAE (Q9HXH0) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 950 Score = 31.6 bits (70), Expect = 1.2 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y P +E SWY WES Y Sbjct: 1 MDKTYQPHAIETSWYETWESNDY 23
>SYV_BDEBA (Q6MQK8) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 894 Score = 31.2 bits (69), Expect = 1.6 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +1 Query: 418 LAPXMAKQYSPSTVEKSWYAWWESAGY 498 ++ ++ +Y+P+ VE Y WWE GY Sbjct: 3 MSEQLSDRYNPADVESRTYEWWEKNGY 29
>SYV_XANAC (Q8PGQ7) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 944 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +A Y PS+ E YA WE+AGY Sbjct: 4 LASSYDPSSFESRLYAQWEAAGY 26
>SYV_PHOLL (Q7MZ25) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 965 Score = 31.2 bits (69), Expect = 1.6 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 391 ETPSGQKKSLAPXMAKQYSPSTVEKSWYAWWESAGY 498 +TP+ Q ++ P + K Y+P +E+ Y WE +GY Sbjct: 3 KTPATQTQA-EPSLDKTYNPKEIEQPLYNHWEKSGY 37
>SYV_XANOR (Q5H4N5) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 980 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +A Y PS+ E YA WE+AGY Sbjct: 4 LASSYDPSSFESRLYAQWEAAGY 26
>SYV_XANC5 (Q3BP98) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 980 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +A Y PS+ E YA WE+AGY Sbjct: 4 LASSYDPSSFESRLYAQWEAAGY 26
>SYV_METCA (Q606C1) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 921 Score = 31.2 bits (69), Expect = 1.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y P +E+ WY WE++G+ Sbjct: 1 MDKVYEPHAIEQRWYQHWEASGF 23
>SYV_AZOSE (Q5NXL5) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 948 Score = 31.2 bits (69), Expect = 1.6 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +AK + P+ +E WY WES G+ Sbjct: 3 LAKSFEPAAIEARWYPEWESRGH 25
>UPPS2_CORGL (Q8NNC1) Undecaprenyl pyrophosphate synthetase 2 (EC 2.5.1.31) (UPP| synthetase 2) (Di-trans,poly-cis-decaprenylcistransferase 2) (Undecaprenyl diphosphate synthase 2) (UDS 2) Length = 243 Score = 31.2 bits (69), Expect = 1.6 Identities = 14/43 (32%), Positives = 25/43 (58%) Frame = +2 Query: 371 PKISLILRPLVGRRNRLHLXWLSSIAQVQWKNRGMPGGSQQDI 499 P + L LRP +R L W S+ A++ ++++ P +QQD+ Sbjct: 184 PDVDLFLRPSGEKRTSNFLLWQSAYAEMVYQDKLFPDFTQQDL 226
>CX017_HUMAN (Q9NX05) Protein CXorf17 (Tumor antigen BJ-HCC-21)| Length = 1096 Score = 31.2 bits (69), Expect = 1.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +3 Query: 72 SAGARPRRRDHPYHPISHHGEAR 140 S GA P R HP H HHG+A+ Sbjct: 76 SGGAGPTRHHHPAHHFHHHGQAQ 98
>CX017_MOUSE (Q8C3F2) Protein CXorf17 homolog| Length = 1091 Score = 30.8 bits (68), Expect = 2.1 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = +3 Query: 72 SAGARPRRRDHPYHPISHHGEA 137 S GA P R HP H HHG+A Sbjct: 76 SGGAGPSRHHHPAHHFHHHGQA 97
>SYV_FUSNN (Q8RHK3) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 887 Score = 30.8 bits (68), Expect = 2.1 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 436 KQYSPSTVEKSWYAWWESAGY 498 K YSP+ +E+ WY WE + Y Sbjct: 6 KNYSPNEIEEKWYKIWEDSKY 26
>SYV_PHOPR (Q6LUW1) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 953 Score = 30.8 bits (68), Expect = 2.1 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y+P ++E++ Y WE AGY Sbjct: 1 MEKTYNPQSIEQALYQRWEEAGY 23
>SYV_XANCP (Q8PCR7) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 944 Score = 30.4 bits (67), Expect = 2.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +A Y PS+ E YA WESAG+ Sbjct: 4 LASSYDPSSFESRLYAQWESAGH 26
>SYV_XANC8 (Q4UQP3) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 944 Score = 30.4 bits (67), Expect = 2.7 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +A Y PS+ E YA WESAG+ Sbjct: 4 LASSYDPSSFESRLYAQWESAGH 26
>SYV_PASMU (Q9CMK5) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 954 Score = 30.4 bits (67), Expect = 2.7 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 MA +++PS VE++ Y WE +GY Sbjct: 7 MADRFTPSAVEQALYKHWEESGY 29
>SYV_HAEI8 (Q4QKA4) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 954 Score = 30.4 bits (67), Expect = 2.7 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 MA +++PS VE++ Y WE +GY Sbjct: 7 MADRFNPSAVEQALYQHWEESGY 29
>SYV_DECAR (Q47BG6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 943 Score = 30.0 bits (66), Expect = 3.6 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +AK + P+ +E+ WY WE+ Y Sbjct: 3 LAKAFEPADIERRWYPEWETQNY 25
>SYV_CLOAB (Q97GG8) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 881 Score = 30.0 bits (66), Expect = 3.6 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 MAK Y P E Y WWE G+ Sbjct: 7 MAKTYDPKEFEDRIYKWWEEEGF 29
>SYV_BURPS (Q63TI8) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 955 Score = 30.0 bits (66), Expect = 3.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +AK + P T+E W WE GY Sbjct: 6 LAKSFEPQTIESQWGPEWEKRGY 28
>SYV_BURMA (Q62KW5) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 955 Score = 30.0 bits (66), Expect = 3.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 +AK + P T+E W WE GY Sbjct: 6 LAKSFEPQTIESQWGPEWEKRGY 28
>SYV_HAEIN (P43834) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 954 Score = 30.0 bits (66), Expect = 3.6 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 MA +++PS VE++ Y WE +GY Sbjct: 7 MADRFNPSAVEQALYQRWEESGY 29
>SYV_IDILO (Q5QY15) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 949 Score = 29.6 bits (65), Expect = 4.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K YSP+ +E+ Y WE GY Sbjct: 1 MDKTYSPAAIEQDLYQQWEDKGY 23
>SYLA_AQUAE (O66680) Leucyl-tRNA synthetase alpha subunit (EC 6.1.1.4)| (Leucine--tRNA ligase alpha subunit) (LeuRS) Length = 634 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAG 495 M K+++P +EK W WE AG Sbjct: 1 MMKEFNPREIEKKWQKRWEEAG 22
>UPPS2_CORDI (P60481) Undecaprenyl pyrophosphate synthetase 2 (EC 2.5.1.31) (UPP| synthetase 2) (Di-trans,poly-cis-decaprenylcistransferase 2) (Undecaprenyl diphosphate synthase 2) (UDS 2) Length = 245 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 371 PKISLILRPLVGRRNRLHLXWLSSIAQVQWKNRGMPGGSQQDI 499 P + L LRP +R L W S+ A++ ++N+ P + +D+ Sbjct: 185 PDVDLFLRPSGEKRTSNFLLWQSAYAEMVYQNKLFPDYTPEDL 227
>SYV_NOCFA (Q5Z048) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 893 Score = 29.6 bits (65), Expect = 4.7 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +1 Query: 394 TPSGQKKSLAPXMAKQYSPSTVEKSWYAWWESAGY 498 T ++ A + K + PS VE Y W SAGY Sbjct: 4 TAPDNSRNRADALPKSWDPSAVEAEMYERWVSAGY 38
>SYV_VIBPA (Q87LG6) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 952 Score = 29.6 bits (65), Expect = 4.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y+P+++E++ Y WE GY Sbjct: 1 MEKTYNPTSIEQALYQTWEEKGY 23
>SYV_VIBVY (Q7MHG1) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 951 Score = 29.3 bits (64), Expect = 6.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y+P+++E+ Y WE GY Sbjct: 1 MEKTYNPTSIEQDLYKTWEEQGY 23
>SYV_VIBVU (Q8DCE7) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 951 Score = 29.3 bits (64), Expect = 6.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y+P+++E+ Y WE GY Sbjct: 1 MEKTYNPTSIEQDLYKTWEEQGY 23
>SYV_PSEHT (Q3II73) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 951 Score = 29.3 bits (64), Expect = 6.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y+P +E+S Y WE GY Sbjct: 1 MDKTYNPQDIEQSLYQGWEEKGY 23
>SYV_VIBF1 (Q5E7U0) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 957 Score = 29.3 bits (64), Expect = 6.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y+P ++E++ Y WE GY Sbjct: 1 MEKTYNPQSIEQTLYQTWEEKGY 23
>SYV_VIBCH (Q9KP73) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 953 Score = 29.3 bits (64), Expect = 6.1 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K Y+P+++E+ Y WE GY Sbjct: 1 MEKTYNPTSIEQDLYKTWEEQGY 23
>SYV_WOLSU (Q7M8H7) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 894 Score = 28.9 bits (63), Expect = 7.9 Identities = 10/21 (47%), Positives = 15/21 (71%) Frame = +1 Query: 436 KQYSPSTVEKSWYAWWESAGY 498 K Y+P +E+S+Y WE+ GY Sbjct: 26 KGYNPREIEESYYKIWETRGY 46
>SYV_BACSK (Q5WEQ4) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 880 Score = 28.9 bits (63), Expect = 7.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWW 483 M +Y PS EK WY +W Sbjct: 7 MPTKYDPSATEKKWYTYW 24
>SYV_RALSO (Q8XX80) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 968 Score = 28.9 bits (63), Expect = 7.9 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAG 495 +AK + P+ +E+ W A WE+ G Sbjct: 8 LAKSFEPAAIEQKWSAAWEAMG 29
>SYV_PELCD (Q3A253) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 899 Score = 28.9 bits (63), Expect = 7.9 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = +1 Query: 418 LAPXMAKQYSPSTVEKSWYAWWESAG 495 + P + K Y P VE WY +W G Sbjct: 15 MEPKLPKGYEPHDVEAKWYEFWTENG 40
>SYV_LEGPL (Q5WYI0) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 921 Score = 28.9 bits (63), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K YSP +EK+ Y WES Y Sbjct: 1 MDKTYSPEAIEKALYKKWESHHY 23
>SYV_LEGPH (Q5ZXL2) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 921 Score = 28.9 bits (63), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K YSP +EK+ Y WES Y Sbjct: 1 MDKTYSPEAIEKALYKKWESHHY 23
>SYV_LEGPA (Q5X728) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 921 Score = 28.9 bits (63), Expect = 7.9 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAGY 498 M K YSP +EK+ Y WES Y Sbjct: 1 MDKTYSPEAIEKALYKKWESHHY 23
>SYV_SPHEL (Q7X2N3) Valyl-tRNA synthetase (EC 6.1.1.9) (Valine--tRNA ligase)| (ValRS) Length = 811 Score = 28.9 bits (63), Expect = 7.9 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 430 MAKQYSPSTVEKSWYAWWESAG 495 + K + P+ +E WYA WE G Sbjct: 4 LPKTFDPAEIESRWYAHWEDEG 25
>UPPS2_COREF (Q8FNG2) Undecaprenyl pyrophosphate synthetase 2 (EC 2.5.1.31) (UPP| synthetase 2) (Di-trans,poly-cis-decaprenylcistransferase 2) (Undecaprenyl diphosphate synthase 2) (UDS 2) Length = 243 Score = 28.9 bits (63), Expect = 7.9 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = +2 Query: 371 PKISLILRPLVGRRNRLHLXWLSSIAQVQWKNRGMPGGSQQDI 499 P + L LRP +R L W S+ A++ ++++ P + QD+ Sbjct: 184 PDVDLFLRPSGEKRTSNFLLWQSAYAEMVYQDKLFPDFTPQDL 226 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.124 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,895,519 Number of Sequences: 219361 Number of extensions: 561595 Number of successful extensions: 1612 Number of sequences better than 10.0: 66 Number of HSP's better than 10.0 without gapping: 1580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1612 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.7 bits)