| Clone Name | bastl30b07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GLMU_BACSK (Q5WAD9) Bifunctional protein glmU [Includes: UDP-N-a... | 30 | 3.0 | 2 | UL17_EHV1B (P28950) Gene 45 protein | 30 | 3.9 | 3 | Y255_MYCGE (P47497) Hypothetical protein MG255 | 29 | 6.7 | 4 | Y969_VIBPA (Q87R29) UPF0227 protein VP0969 | 28 | 8.7 | 5 | Y358_MYCPN (P75422) Hypothetical protein MG255 homolog (H91_orf534) | 28 | 8.7 |
|---|
>GLMU_BACSK (Q5WAD9) Bifunctional protein glmU [Includes:| UDP-N-acetylglucosamine pyrophosphorylase (EC 2.7.7.23) (N-acetylglucosamine-1-phosphate uridyltransferase); Glucosamine-1-phosphate N-acetyltransferase (EC 2.3.1.157)] Length = 454 Score = 30.0 bits (66), Expect = 3.0 Identities = 16/57 (28%), Positives = 25/57 (43%) Frame = +3 Query: 234 TTWRSTGSTVGMPVVLVLVSQLGGPRSHKKAPAYISS*CAVKEGVHVMSLNSGSGPH 404 TT+ S +++G VL P + K P+ I C ++ G + S G G H Sbjct: 260 TTYISADASIGQDTVLY-------PNTSIKGPSVIGEDCVIESGTEIASATLGRGVH 309
>UL17_EHV1B (P28950) Gene 45 protein| Length = 706 Score = 29.6 bits (65), Expect = 3.9 Identities = 20/58 (34%), Positives = 27/58 (46%) Frame = -1 Query: 456 NLSPHNFTRILAGQLVVDEARFLNLGS*RGRPPLQHISSRYKQVPSCENEDLLTETPK 283 N S H+ T +L G D RF+N G R PP S + S +D+L TP+ Sbjct: 304 NSSIHDATALLLGLEPPDSGRFVNSGPQRHLPPQGPRSPASRDCQSGMLDDVLLLTPE 361
>Y255_MYCGE (P47497) Hypothetical protein MG255| Length = 365 Score = 28.9 bits (63), Expect = 6.7 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +3 Query: 201 LAFQKLAWCSITTWRSTGSTVGMPVVLVLVSQLGGPRSHKKAPAYI 338 L+F K W +TT + G+T+G PV + ++Q G + + +I Sbjct: 142 LSFIKQQWPILTTLVTVGTTLGTPVFSLTIAQQDGIKQNAGNDVFI 187
>Y969_VIBPA (Q87R29) UPF0227 protein VP0969| Length = 179 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/45 (26%), Positives = 24/45 (53%) Frame = -1 Query: 459 NNLSPHNFTRILAGQLVVDEARFLNLGS*RGRPPLQHISSRYKQV 325 ++ SP N ++L Q + D+ RF+N + + +QH+ +V Sbjct: 9 DSTSPGNHEKVLQLQFIDDDVRFINYSTLHPKHDMQHLLKEVSKV 53
>Y358_MYCPN (P75422) Hypothetical protein MG255 homolog (H91_orf534)| Length = 534 Score = 28.5 bits (62), Expect = 8.7 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 201 LAFQKLAWCSITTWRSTGSTVGMPVVLVLVSQ 296 L+F K W +TT + G+T+G P+ + +SQ Sbjct: 140 LSFIKEQWPILTTLVTVGTTLGTPIFSITISQ 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,250,847 Number of Sequences: 219361 Number of extensions: 1082604 Number of successful extensions: 2327 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2292 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2327 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)