Clone Name | bastl29h12 |
---|---|
Clone Library Name | barley_pub |
>SPY_HORVU (O82422) Probable UDP-N-acetylglucosamine--peptide| N-acetylglucosaminyltransferase SPINDLY (EC 2.4.1.-) (HvSPY) Length = 944 Score = 49.7 bits (117), Expect = 2e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +3 Query: 270 MESLQGKESNGAVPVCNGGGGA 335 MESLQGKESNGAVPVCNGGGGA Sbjct: 1 MESLQGKESNGAVPVCNGGGGA 22
>SPY_ORYSA (Q6YZI0) Probable UDP-N-acetylglucosamine--peptide| N-acetylglucosaminyltransferase SPINDLY (EC 2.4.1.-) Length = 927 Score = 34.3 bits (77), Expect = 0.079 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 264 PGMESLQGKESNGAVPVCNGG 326 PGM+S +G+ESNG VP NGG Sbjct: 4 PGMDSSEGRESNGVVPERNGG 24
>FXL19_MOUSE (Q6PB97) F-box/LRR-repeat protein 19 (F-box and leucine-rich repeat| protein 19) Length = 674 Score = 32.0 bits (71), Expect = 0.39 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -2 Query: 331 PPPPLQTGTAPLLSFPWRDSIPGCTNERERE 239 PPPPL PL + P D +PG +ERE Sbjct: 168 PPPPLPRRKGPLPAGPTPDDVPGPPKRKERE 198
>YICF_ECOLI (P25772) Hypothetical DNA ligase-like protein yicF| Length = 560 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = -2 Query: 295 LSFPWRDSIPGCTNERERERVSFSLPSYWRAAPGTGAGR 179 + P + ++ER ++ FS +W+ PGTG+GR Sbjct: 492 MGIPLTRAALNASDERSWSQLLFSTEQFWQQLPGTGSGR 530
>ADA2B_MACPR (O19025) Alpha-2B adrenergic receptor (Alpha-2B adrenoceptor)| (Alpha-2B adrenoreceptor) (Fragment) Length = 387 Score = 27.7 bits (60), Expect = 7.4 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = -2 Query: 334 APPPPLQTGTAPLLSFPWRDSIPGCTNERE--RERVSFSLPSYWRAAPGTGAGRRE 173 A PP L T+PL + T ERE + VS + P W A P +G GR+E Sbjct: 220 ARPPAL---TSPLAVTGEANGHSKPTGERETPEDLVSPASPPSWPAIPNSGQGRKE 272
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 27.7 bits (60), Expect = 7.4 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 5/33 (15%) Frame = -3 Query: 306 RRRCSPSLGGTPSLDARMKE-----RERGSPSP 223 RRR SPS +PS R KE R R SPSP Sbjct: 520 RRRHSPSRSASPSPRKRQKETSPRGRRRRSPSP 552
>MBD6_HUMAN (Q96DN6) Methyl-CpG-binding domain protein 6 (Methyl-CpG-binding| protein MBD6) Length = 1003 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 331 PPPPLQTGTAPLLSFPWRDSIPGCTN 254 PPP L +G+ P P + S+PG T+ Sbjct: 441 PPPTLSSGSPPQPRHPIQPSLPGTTS 466
>Y2401_ARCFU (O30270) Hypothetical protein AF2401| Length = 348 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 301 PLLSFPWRDSIPGCTNERERERV 233 P LSFPW I N R RE+V Sbjct: 309 PALSFPWERRIIESRNRRRREKV 331
>VGNM_CPMV (P03599) Genome polyprotein M (RNA2 polyprotein) [Contains: Movement| protein (MP); Large coat protein (LCP) (Coat protein VP37); Small coat protein, N-terminus part (SCP) (Coat protein VP23); Small coat protein, C-terminus part] Length = 1046 Score = 27.3 bits (59), Expect = 9.7 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 331 PPPPLQTGTAPLLSFPWRD 275 PP PL T T PLL F +RD Sbjct: 1011 PPFPLSTETPPLLKFRFRD 1029 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,459,001 Number of Sequences: 219361 Number of extensions: 502395 Number of successful extensions: 1791 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1759 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1791 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)