Clone Name | bastl29g01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ALF1_LAMJA (P53445) Fructose-bisphosphate aldolase, muscle type ... | 30 | 2.0 | 2 | FIG2_YEAST (P25653) Factor-induced gene 2 precursor (Cell wall a... | 30 | 2.6 | 3 | C2TA_HUMAN (P33076) MHC class II transactivator (CIITA) | 29 | 4.4 |
---|
>ALF1_LAMJA (P53445) Fructose-bisphosphate aldolase, muscle type (EC 4.1.2.13)| Length = 363 Score = 30.4 bits (67), Expect = 2.0 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = -3 Query: 189 ALQASTISRWGGRRKCLSDLVEEL*KGCAIHGMEHARTRAPAG 61 ALQAS + WGG+++ L +EL + I+G P G Sbjct: 305 ALQASVLKAWGGKKENLKAAQDELMRRAKINGQASKGEYKPTG 347
>FIG2_YEAST (P25653) Factor-induced gene 2 precursor (Cell wall adhesin FIG2)| Length = 1609 Score = 30.0 bits (66), Expect = 2.6 Identities = 18/44 (40%), Positives = 23/44 (52%) Frame = +3 Query: 33 VASTPTSAQALPVRAYVRAPFRGSHSLFTALLPNQRGTSSFLPT 164 + ST TS LP + + A S SL + LP+ TSS LPT Sbjct: 1268 LTSTHTSVPLLPSSSSISASSPSSTSLLSTSLPSPAFTSSTLPT 1311
>C2TA_HUMAN (P33076) MHC class II transactivator (CIITA)| Length = 1130 Score = 29.3 bits (64), Expect = 4.4 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 14 CSEVPCSGVDAYLGSSPAGARVRACSIPWIAQPFHSSS 127 CS +PC + A PA ++R I PF SSS Sbjct: 179 CSTLPCLPLPALFNQEPASGQMRLEKTDQIPMPFSSSS 216 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,044,300 Number of Sequences: 219361 Number of extensions: 644250 Number of successful extensions: 1646 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1615 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1646 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2570413340 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)