Clone Name | bastl29c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FGD5_MOUSE (Q80UZ0) FYVE, RhoGEF and PH domain-containing protein 5 | 29 | 6.3 |
---|
>FGD5_MOUSE (Q80UZ0) FYVE, RhoGEF and PH domain-containing protein 5| Length = 1219 Score = 28.9 bits (63), Expect = 6.3 Identities = 13/33 (39%), Positives = 18/33 (54%) Frame = +2 Query: 284 LQPGNIFPHDGMVSRARGGDGENRHVFISEYTI 382 LQPG F +G + R RG RH+F+ T+ Sbjct: 864 LQPGREFLKEGTLMRVRGKSRHPRHLFLMNDTL 896 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,663,451 Number of Sequences: 219361 Number of extensions: 847724 Number of successful extensions: 2801 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2670 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2800 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)