Clone Name | bastl28h07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VP3_ARMV (P24820) P3 protein | 29 | 5.1 | 2 | Y907_MYCBO (P64740) Hypothetical protein Mb0907c | 28 | 8.8 | 3 | Y883_MYCTU (P64739) Hypothetical protein Rv0883c/MT0906 | 28 | 8.8 |
---|
>VP3_ARMV (P24820) P3 protein| Length = 360 Score = 28.9 bits (63), Expect = 5.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 398 EPAGRWCPAVRPADRWR*QP 339 EP G W PA + A RW QP Sbjct: 262 EPVGFWAPAEKQAPRWEGQP 281
>Y907_MYCBO (P64740) Hypothetical protein Mb0907c| Length = 253 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 129 PGPLWWDRRAWRGEETRGDETKAGKEGRNQNV 34 P L WD AWR E++R A K GR+ N+ Sbjct: 137 PDSLTWD--AWRNEDSRWTVQLAWKAGRSDNL 166
>Y883_MYCTU (P64739) Hypothetical protein Rv0883c/MT0906| Length = 253 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -3 Query: 129 PGPLWWDRRAWRGEETRGDETKAGKEGRNQNV 34 P L WD AWR E++R A K GR+ N+ Sbjct: 137 PDSLTWD--AWRNEDSRWTVQLAWKAGRSDNL 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,371,742 Number of Sequences: 219361 Number of extensions: 432350 Number of successful extensions: 1322 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1322 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)