Clone Name | bastl28e10 |
---|---|
Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 49.3 bits (116), Expect = 4e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = +2 Query: 293 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLK 421 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLK Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLK 97
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 49.3 bits (116), Expect = 4e-06 Identities = 24/43 (55%), Positives = 33/43 (76%) Frame = +2 Query: 293 QLELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLK 421 +LE+ V R + D + R ALE +R++IRS+T+SMTSVPKPLK Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLK 97
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 42.4 bits (98), Expect = 4e-04 Identities = 19/42 (45%), Positives = 31/42 (73%) Frame = +2 Query: 296 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLK 421 LEL V R ++ D + +L ++++ I+++TSSMT+VPKPLK Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLK 89
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 42.0 bits (97), Expect = 6e-04 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +2 Query: 296 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLK 421 LEL V QD P + +L +++ IR++TSSMT+VPKPLK Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPLK 98
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 40.0 bits (92), Expect = 0.002 Identities = 18/34 (52%), Positives = 27/34 (79%) Frame = +2 Query: 320 QDVDPGVQRLALESMRQEIRSATSSMTSVPKPLK 421 Q+ D + + ALE+M+ I+++TSSMT+VPKPLK Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVPKPLK 81
>RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1| Length = 983 Score = 35.0 bits (79), Expect = 0.072 Identities = 17/42 (40%), Positives = 27/42 (64%) Frame = +2 Query: 296 LELYVVRAQDVDPGVQRLALESMRQEIRSATSSMTSVPKPLK 421 LE+ V + D + L +++ I+++TSSMT+VPKPLK Sbjct: 49 LEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLK 90
>ELL2_HUMAN (O00472) RNA polymerase II elongation factor ELL2| Length = 640 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +1 Query: 37 PTQQRRVASVPLAPRTLASP-PAPSPNRIRPASH 135 PT ++ A +PL P A P P P P+ P SH Sbjct: 354 PTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISH 387
>PCY2_RAT (O88637) Ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14)| (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 404 Score = 29.6 bits (65), Expect = 3.0 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 119 IRFGDGAGGLARVRGASGTEATRRCCVGVY 30 IR G GAGG A ++G G R C G Y Sbjct: 2 IRNGHGAGGAAGLKGPGGQRTVRVWCDGCY 31
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 29.6 bits (65), Expect = 3.0 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +1 Query: 37 PTQQRRVASVPLAPRTLASPPAPSPNRIRPA 129 P ++ +A VPLAP +PP+P+P R A Sbjct: 1129 PPKEGVLAQVPLAPPQPGAPPSPAPARFSTA 1159
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 28.9 bits (63), Expect = 5.1 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +1 Query: 37 PTQQRRVASVPLAPRTLASPPAP--SPNRIRPAS 132 PTQQ +VP AP +S PAP SPN I P++ Sbjct: 15 PTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSN 48
>DYNA_RAT (P28023) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1280 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 6 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 101 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_HUMAN (Q14203) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) (p135) Length = 1278 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 6 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 101 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_MOUSE (O08788) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1281 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +3 Query: 6 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 101 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2158 Score = 28.1 bits (61), Expect = 8.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 37 PTQQRRVASVPLAPRTLASPPAPSPNRIRPA 129 P ++ + VPLAP +PP+P+P R A Sbjct: 1124 PPKEGVLGQVPLAPPQPGAPPSPAPARFSTA 1154
>YK57_YEAST (P36157) Hypothetical 39.9 kDa protein in SIS2-MTD1 intergenic| region Length = 363 Score = 28.1 bits (61), Expect = 8.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 34 TPTQQRRVASVPLAPRTLASPPAPSPNRIRPAS 132 TP QQ+R +S P + TL P +P+ P+S Sbjct: 5 TPQQQQRFSSTPQSSHTLIFSPIRAPSMQTPSS 37
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 37 PTQQRRVASVPLAPRTLASPPAPSPNR 117 P ++ + VPLAP +PP+P+P R Sbjct: 1129 PPKEGTLTQVPLAPPPPGAPPSPAPAR 1155
>YACF_SALTY (P67693) UPF0289 protein yacF| Length = 247 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 332 PGVQRLALESMRQEIRSATSSMTSVPK 412 PGV + +E++RQ+++SA S + S P+ Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAPR 107
>YACF_SALTI (P67694) UPF0289 protein yacF| Length = 247 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 332 PGVQRLALESMRQEIRSATSSMTSVPK 412 PGV + +E++RQ+++SA S + S P+ Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAPR 107
>YACF_SALPA (Q5PDD7) UPF0289 protein yacF| Length = 247 Score = 28.1 bits (61), Expect = 8.8 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +2 Query: 332 PGVQRLALESMRQEIRSATSSMTSVPK 412 PGV + +E++RQ+++SA S + S P+ Sbjct: 81 PGVDQDRIEALRQQLKSAGSVLISAPR 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.132 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,260,741 Number of Sequences: 219361 Number of extensions: 363660 Number of successful extensions: 2090 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 1925 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2079 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)