Clone Name | bastl28e04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y080_MYCPN (P75613) Hypothetical protein MG064 homolog (R02_orf1... | 29 | 6.3 | 2 | RL15_PSEPK (Q88QL6) 50S ribosomal protein L15 | 28 | 8.2 | 3 | RL15_PSEF5 (Q4K552) 50S ribosomal protein L15 | 28 | 8.2 |
---|
>Y080_MYCPN (P75613) Hypothetical protein MG064 homolog (R02_orf1386)| Length = 1386 Score = 28.9 bits (63), Expect = 6.3 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 262 RRLAAYLTAPAVESVIARLPSWRHALDFF-RWA 357 R +++LT P ++ARLP+ H LD +WA Sbjct: 440 RTASSFLTNPTETGIVARLPNLNHDLDVINQWA 472
>RL15_PSEPK (Q88QL6) 50S ribosomal protein L15| Length = 144 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 99 ESHRDGRILRSGVGAEGGRYAVGDTGGLSG 10 E HR GR + SG+G GGR G T G Sbjct: 15 EKHRPGRGIGSGLGKTGGRGHKGQTSRSGG 44
>RL15_PSEF5 (Q4K552) 50S ribosomal protein L15| Length = 144 Score = 28.5 bits (62), Expect = 8.2 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 99 ESHRDGRILRSGVGAEGGRYAVGDTGGLSG 10 E HR GR + SG+G GGR G T G Sbjct: 15 EKHRPGRGIGSGLGKTGGRGHKGQTSRSGG 44 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,979,306 Number of Sequences: 219361 Number of extensions: 591256 Number of successful extensions: 2153 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1988 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2151 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)