Clone Name | bastl28d07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | SYD_RALEJ (Q475W2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspar... | 31 | 1.7 | 2 | PATL2_ARATH (Q56ZI2) Patellin-2 | 30 | 2.9 | 3 | Y2912_DESPS (Q6AJ39) UPF0316 protein DP2912 | 30 | 4.9 | 4 | PSG1_HUMAN (P11464) Pregnancy-specific beta-1-glycoprotein 1 pre... | 30 | 4.9 | 5 | NOS2_CHICK (Q90703) Nitric oxide synthase, inducible (EC 1.14.13... | 29 | 6.4 | 6 | PLCB1_RAT (P10687) 1-phosphatidylinositol-4,5-bisphosphate phosp... | 29 | 8.3 |
---|
>SYD_RALEJ (Q475W2) Aspartyl-tRNA synthetase (EC 6.1.1.12) (Aspartate--tRNA| ligase) (AspRS) Length = 602 Score = 31.2 bits (69), Expect = 1.7 Identities = 17/59 (28%), Positives = 30/59 (50%) Frame = -1 Query: 222 GCAFMLSSIITIYSQVIKLRDLLDFTNFRALLDFTSI*KRIINLGAIRPMHLYLRATWP 46 G AF L I+T+ + +RD++ F + D + ++ +R +H+ LRAT P Sbjct: 540 GLAFGLDRIVTMMAGADSIRDVIAFPKTQRAQDLLTQAPSAVDEKQLRELHIRLRATEP 598
>PATL2_ARATH (Q56ZI2) Patellin-2| Length = 683 Score = 30.4 bits (67), Expect = 2.9 Identities = 23/81 (28%), Positives = 31/81 (38%), Gaps = 8/81 (9%) Frame = +1 Query: 238 PPPAKAPLSEEAKDARKALAT--------IYDKVLVVDTVESARSVVQLLTTKYKSFIHA 393 PPP AP+ EE + +K T +K L +T E +S K I A Sbjct: 117 PPPPPAPVKEEKVEEKKTEETEEKKEEVKTEEKSLEAETKEEEKSAAPATVETKKEEILA 176 Query: 394 CDTEVSNIDVKQETPVGHGDV 456 + K+ETPV V Sbjct: 177 APAPIVAETKKEETPVAPAPV 197
>Y2912_DESPS (Q6AJ39) UPF0316 protein DP2912| Length = 318 Score = 29.6 bits (65), Expect = 4.9 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 227 QRCSLLQLKPPCLRRLKMHGRLL 295 QRC L +L PPC+ + +HG L Sbjct: 288 QRCGLARLTPPCISQRALHGTSL 310
>PSG1_HUMAN (P11464) Pregnancy-specific beta-1-glycoprotein 1 precursor| (PSBG-1) (Pregnancy-specific beta-1 glycoprotein C/D) (PS-beta-C/D) (Fetal liver non-specific cross-reactive antigen 1/2) (FL-NCA-1/2) (PSG95) (CD66f antigen) Length = 419 Score = 29.6 bits (65), Expect = 4.9 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 254 PPCLRRLKMHGRLLLPSTTKFWWLTRSNQL 343 PPC +R+K G LL S FW L + Q+ Sbjct: 7 PPCTQRIKWKGLLLTASLLNFWNLPTTAQV 36
>NOS2_CHICK (Q90703) Nitric oxide synthase, inducible (EC 1.14.13.39) (NOS type| II) (Inducible NO synthase) (Inducible NOS) (iNOS) (Macrophage NOS) Length = 1136 Score = 29.3 bits (64), Expect = 6.4 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 370 KYKSFIHACDTEVSNIDVKQETPVGHGD 453 ++ +F HA D ++S + Q TPVG GD Sbjct: 630 EFCAFAHAIDQKLSQLGALQLTPVGEGD 657
>PLCB1_RAT (P10687) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| beta 1 (EC 3.1.4.11) (Phosphoinositide phospholipase C) (Phospholipase C-beta-1) (PLC-beta-1) (PLC-I) (PLC-154) Length = 1216 Score = 28.9 bits (63), Expect = 8.3 Identities = 21/64 (32%), Positives = 32/64 (50%) Frame = +1 Query: 196 NGAEHECTAKTAVQPPPAKAPLSEEAKDARKALATIYDKVLVVDTVESARSVVQLLTTKY 375 NG H T PP++AP S+ A + KA A D + V T A+++ +L + Sbjct: 862 NGVNHTATL---APKPPSQAPHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEEL--KQQ 916 Query: 376 KSFI 387 KSF+ Sbjct: 917 KSFV 920 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.311 0.129 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,397,208 Number of Sequences: 219361 Number of extensions: 1201343 Number of successful extensions: 2583 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2579 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3696665728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.8 bits)