| Clone Name | bastl28c02 |
|---|---|
| Clone Library Name | barley_pub |
>SMRC2_MOUSE (Q6PDG5) SWI/SNF-related matrix-associated actin-dependent regulator| of chromatin subfamily C member 2 (SWI/SNF complex 170 kDa subunit) (BRG1-associated factor 170) Length = 1213 Score = 30.8 bits (68), Expect = 1.9 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = +3 Query: 153 AAAPPGTGSGSPSIEPRAAIIRKRNRGGREQPFGFGLVSPLPLPP 287 A+APPG+G+ S+ P I + G +QP G P +PP Sbjct: 994 ASAPPGSGAPPGSLGPSEQIGQAGTTAGPQQPQQAGAPQPGAVPP 1038
>GPC2_MOUSE (Q8BKV1) Glypican-2 precursor| Length = 579 Score = 30.0 bits (66), Expect = 3.2 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 133 PHRAQSRLLRRPGREXXXXXXXXXXXXSEKETEEGGSNRSGLVWFRRSR 279 PH QSR R P E+ T G+N LVW R R Sbjct: 349 PHPVQSRSRRAPAPREEASRSWRASAEEERPTTAAGTNLHRLVWELRER 397
>MA2B1_FELCA (O46432) Lysosomal alpha-mannosidase precursor (EC 3.2.1.24)| (Mannosidase, alpha B) (Lysosomal acid alpha-mannosidase) (Laman) (Mannosidase alpha class 2B member 1) Length = 1007 Score = 29.6 bits (65), Expect = 4.2 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 5/38 (13%) Frame = -2 Query: 292 QAGGSGSGETKPNPNGCSLPP-----LFLFLIMAARGS 194 +AGG G G +P + +LPP FL L++AA G+ Sbjct: 11 RAGGGGRGAARPGTSSRALPPPLPPLSFLLLLLAAPGA 48
>GPC2_RAT (P51653) Glypican-2 precursor (Cerebroglycan) (HSPG M13)| Length = 579 Score = 29.6 bits (65), Expect = 4.2 Identities = 16/49 (32%), Positives = 18/49 (36%) Frame = +1 Query: 133 PHRAQSRLLRRPGREXXXXXXXXXXXXSEKETEEGGSNRSGLVWFRRSR 279 PH QSR R P E+ T G+N LVW R R Sbjct: 349 PHPVQSRNRRAPAPREETSRSWRSSAEEERPTTAAGTNLHRLVWELRER 397
>G6B_RAT (Q6MG59) G6b protein precursor| Length = 232 Score = 29.3 bits (64), Expect = 5.5 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 5/35 (14%) Frame = +1 Query: 238 GSNRSGLVWFRRS-----RSLPLASQEPRRPLQEE 327 G GLVW+RRS P+ + EP+RPL+++ Sbjct: 153 GLGALGLVWWRRSCVPPSHIAPVINAEPQRPLEQD 187
>RBM15_HUMAN (Q96T37) Putative RNA-binding protein 15 (RNA-binding motif protein| 15) (One-twenty two protein) Length = 977 Score = 28.9 bits (63), Expect = 7.2 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +3 Query: 162 PPGTGSGSPSIEPRAAIIRKRNRGGREQPFGFGLVSPLPLPP 287 PPG G G S+ P A + R+ R Q G + P P PP Sbjct: 283 PPGGGGGQRSLSPGGAALGYRDY--RLQQLALGRLPPPPPPP 322
>CMAH_ASTRU (Q95V11) Cytidine monophosphate-N-acetylneuraminic acid hydroxylase| (EC 1.14.18.2) (CMP-N-acetylneuraminate monooxygenase) (CMP-N-acetylneuraminic acid hydroxylase) (CMP-NeuAc hydroxylase) (CMP-Neu5Ac hydroxylase) Length = 653 Score = 28.9 bits (63), Expect = 7.2 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = -3 Query: 333 GSFFLQWPPRFLRRKREGAGAAKPNQTRTVAPSLLCFF 220 G + +W F++R+R K Q R VAP++ C F Sbjct: 329 GKYTEEWKAEFVKRERRKLLYYKMQQVRDVAPTVYCPF 366
>VL2_HPV30 (P36756) Minor capsid protein L2| Length = 463 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 381 PRSP*HPFECARNLM-PGSFFLQWPPRFLRRKR 286 P +P PF+ +++ GS F WP FLRR+R Sbjct: 416 PYAPQAPFDTTHDVVIHGSTFALWPVYFLRRRR 448
>VCIP1_HUMAN (Q96JH7) Deubiquitinating protein VCIP135 (EC 3.4.22.-)| (Valosin-containing protein p97/p47 complex-interacting protein p135) (Valosin-containing protein p97/p47 complex-interacting protein 1) Length = 1222 Score = 28.5 bits (62), Expect = 9.4 Identities = 12/25 (48%), Positives = 18/25 (72%), Gaps = 3/25 (12%) Frame = +3 Query: 168 GTGSGSPSIEPRA---AIIRKRNRG 233 GT SG+P ++PRA +++RK N G Sbjct: 1033 GTASGNPHLDPRARETSVVRKHNTG 1057
>POLN_ONNVI (O90370) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC 3.6.1. Length = 2513 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 351 HTQMGARENGEERNEHSTDVEVERDAKQAKEAESDYEASRD 473 H Q+ N EE + TD ER+A+ +EA +A++D Sbjct: 478 HEQLPHSGNAEEAAQAETDAVEEREAELTREAMPPLQATQD 518
>TILS_BARQU (Q6FYQ5) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 476 Score = 28.5 bits (62), Expect = 9.4 Identities = 14/37 (37%), Positives = 25/37 (67%) Frame = +1 Query: 241 SNRSGLVWFRRSRSLPLASQEPRRPLQEEGPRHQVSS 351 SNRSGL ++R SR++ + EP + +G R+Q+++ Sbjct: 345 SNRSGLAFWRESRNIKEGAVEPGKTFLWDG-RYQITN 380
>FABH_STRLI (Q9F6D4) 3-oxoacyl-[acyl-carrier-protein] synthase 3 (EC 2.3.1.41)| (3-oxoacyl-[acyl-carrier-protein] synthase III) (Beta-ketoacyl-ACP synthase III) (KAS III) Length = 339 Score = 28.5 bits (62), Expect = 9.4 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +1 Query: 268 RRSRSLPLASQEPRRPLQEEGPRHQVSSTLKWVLGRTGKREMNI 399 R SR L + S PRR + + + ST +W+ RTG R I Sbjct: 10 RFSRVLGVGSYRPRREVSNKEVCTWIDSTEEWIETRTGIRSRRI 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.314 0.130 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,423,568 Number of Sequences: 219361 Number of extensions: 1128813 Number of successful extensions: 2896 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2800 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2894 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3188886965 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits)