| Clone Name | bastl28b06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AMPN_HAEIN (P45274) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoa... | 35 | 0.14 | 2 | AMPN_ECOLI (P04825) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoa... | 35 | 0.14 | 3 | AMP1_PLAFQ (O96935) M1-family aminopeptidase (EC 3.4.11.-) (Pfa-M1) | 29 | 7.6 | 4 | RL5_THEVO (Q97BW3) 50S ribosomal protein L5P | 28 | 9.9 |
|---|
>AMPN_HAEIN (P45274) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide| hydrolase) Length = 869 Score = 34.7 bits (78), Expect = 0.14 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +3 Query: 366 LPKEIFLKDYKKPDYLFDTVDLEFQLGDEKTIVTS 470 L K + KDYK+PD+ + L+FQL + T+VT+ Sbjct: 2 LAKAKYRKDYKQPDFTVTDIYLDFQLDPKHTVVTA 36
>AMPN_ECOLI (P04825) Aminopeptidase N (EC 3.4.11.2) (Alpha-aminoacylpeptide| hydrolase) Length = 869 Score = 34.7 bits (78), Expect = 0.14 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +3 Query: 369 PKEIFLKDYKKPDYLFDTVDLEFQLGDEKTIVTS 470 P+ + DY+ PDY +DL F L +KT+VT+ Sbjct: 4 PQAKYRHDYRAPDYQITDIDLTFDLDAQKTVVTA 37
>AMP1_PLAFQ (O96935) M1-family aminopeptidase (EC 3.4.11.-) (Pfa-M1)| Length = 1085 Score = 28.9 bits (63), Expect = 7.6 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +3 Query: 369 PKEIFLKDYKKPDYLFDTVDLEFQLGDEKTIVTS 470 PK + KDYK ++ + V L + D +TIV S Sbjct: 196 PKIHYRKDYKPSGFIINNVTLNINIHDNETIVRS 229
>RL5_THEVO (Q97BW3) 50S ribosomal protein L5P| Length = 170 Score = 28.5 bits (62), Expect = 9.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = +3 Query: 366 LPKEIFLKDYKKPDYLFD 419 L K +++KDYK PDY FD Sbjct: 75 LNKALYVKDYKIPDYSFD 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,638,417 Number of Sequences: 219361 Number of extensions: 1148338 Number of successful extensions: 2700 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2620 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2700 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)