ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bastl28a09 |
|---|---|
| Clone Library Name | barley_pub |
>PSD2_MOUSE (Q8VDM4) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) Length = 908 Score = 56.2 bits (134), Expect = 4e-08 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +3 Query: 291 QLELYVVRAQDVDPGVQRLALESMRQEVRSATSSMTSVPKPLRFLRP 431 +LE+ V R + D + R ALE +R+++RS+T+SMTSVPKPL+FLRP Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRP 101
>PSD2_HUMAN (Q13200) 26S proteasome non-ATPase regulatory subunit 2 (26S| proteasome regulatory subunit RPN1) (26S proteasome regulatory subunit S2) (26S proteasome subunit p97) (Tumor necrosis factor type 1 receptor-associated protein 2) (55.11 protein) Length = 908 Score = 56.2 bits (134), Expect = 4e-08 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = +3 Query: 291 QLELYVVRAQDVDPGVQRLALESMRQEVRSATSSMTSVPKPLRFLRP 431 +LE+ V R + D + R ALE +R+++RS+T+SMTSVPKPL+FLRP Sbjct: 55 ELEMLVERLGEKDTSLYRPALEELRRQIRSSTTSMTSVPKPLKFLRP 101
>RPN1_YEAST (P38764) 26S proteasome regulatory subunit RPN1 (Proteasome| non-ATPase subunit 1) Length = 992 Score = 51.2 bits (121), Expect = 1e-06 Identities = 26/65 (40%), Positives = 43/65 (66%), Gaps = 1/65 (1%) Frame = +3 Query: 294 LELYVVRAQDVDPGVQRLALESMRQEVRSATSSMTSVPKPLRFLRPPMEPL-NLLRKYAR 470 LEL V R ++ D + +L ++++ ++++TSSMT+VPKPL+FLRP L ++ K+ Sbjct: 48 LELLVERLKEDDSSLYEASLNALKESIKNSTSSMTAVPKPLKFLRPTYPDLCSIYDKWTD 107 Query: 471 SELKS 485 LKS Sbjct: 108 PNLKS 112
>RPN1_SCHPO (P87048) 26S proteasome regulatory subunit rpn1 (Proteasome| non-ATPase subunit mts4) (19S regulatory cap region of 26S protease subunit 2) Length = 891 Score = 48.9 bits (115), Expect = 7e-06 Identities = 23/46 (50%), Positives = 33/46 (71%) Frame = +3 Query: 294 LELYVVRAQDVDPGVQRLALESMRQEVRSATSSMTSVPKPLRFLRP 431 LEL V QD P + +L +++ +R++TSSMT+VPKPL+FLRP Sbjct: 57 LELLVQAVQDATPELVGSSLTQLKEIIRTSTSSMTAVPKPLKFLRP 102
>RPN1_NEUCR (Q7S8R8) 26S proteasome regulatory subunit rpn-1| Length = 883 Score = 48.9 bits (115), Expect = 7e-06 Identities = 22/46 (47%), Positives = 34/46 (73%) Frame = +3 Query: 318 QDVDPGVQRLALESMRQEVRSATSSMTSVPKPLRFLRPPMEPLNLL 455 Q+ D + + ALE+M+ ++++TSSMT+VPKPL+FLRP E + L Sbjct: 48 QESDATLYKPALEAMKNSIKTSTSSMTAVPKPLKFLRPHYETMTKL 93
>RPN1_CANGA (Q6FPV6) 26S proteasome regulatory subunit RPN1| Length = 983 Score = 42.0 bits (97), Expect = 9e-04 Identities = 19/46 (41%), Positives = 31/46 (67%) Frame = +3 Query: 294 LELYVVRAQDVDPGVQRLALESMRQEVRSATSSMTSVPKPLRFLRP 431 LE+ V + D + L +++ ++++TSSMT+VPKPL+FLRP Sbjct: 49 LEMLVQTLLEDDSKLYETTLTQLKEFIKNSTSSMTAVPKPLKFLRP 94
>BAT2_RAT (Q6MG48) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2161 Score = 30.4 bits (67), Expect = 2.6 Identities = 14/37 (37%), Positives = 22/37 (59%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S ++ P ++ +A VPLAP +PP+P+P R A Sbjct: 1123 SDKEAPPPKEGVLAQVPLAPPQPGAPPSPAPARFSTA 1159
>ELL2_HUMAN (O00472) RNA polymerase II elongation factor ELL2| Length = 640 Score = 29.6 bits (65), Expect = 4.4 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%) Frame = +2 Query: 35 PTQQRRVASVPLAPRTLASP-PAPSPNRIRPASH 133 PT ++ A +PL P A P P P P+ P SH Sbjct: 354 PTSEKSAAGLPLPPAAAAIPTPPPLPSTYLPISH 387
>PCY2_RAT (O88637) Ethanolamine-phosphate cytidylyltransferase (EC 2.7.7.14)| (Phosphorylethanolamine transferase) (CTP:phosphoethanolamine cytidylyltransferase) Length = 404 Score = 29.6 bits (65), Expect = 4.4 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = -1 Query: 117 IRFGDGAGGLARVRGASGTEATRRCCVGVY 28 IR G GAGG A ++G G R C G Y Sbjct: 2 IRNGHGAGGAAGLKGPGGQRTVRVWCDGCY 31
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 29.3 bits (64), Expect = 5.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 592 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 628
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 29.3 bits (64), Expect = 5.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 585 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 621
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 29.3 bits (64), Expect = 5.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 611 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 647
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 29.3 bits (64), Expect = 5.8 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S R+ +P QRR + P R ASPP P R P+ Sbjct: 606 SPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPS 642
>YKY4_CAEEL (Q17963) Hypothetical WD-repeat protein C14B1.4| Length = 376 Score = 28.9 bits (63), Expect = 7.6 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 2/34 (5%) Frame = +2 Query: 35 PTQQRRVASVPLAPRTLASPPAP--SPNRIRPAS 130 PTQQ +VP AP +S PAP SPN I P++ Sbjct: 15 PTQQIDQLTVPNAPDGGSSAPAPSTSPNSISPSN 48
>BORG5_HUMAN (Q00587) Cdc42 effector protein 1 (Binder of Rho GTPases 5) (Serum| protein MSE55) Length = 391 Score = 28.9 bits (63), Expect = 7.6 Identities = 15/32 (46%), Positives = 18/32 (56%) Frame = +2 Query: 14 RSSRK*TPTQQRRVASVPLAPRTLASPPAPSP 109 RS R + + V V PR +ASPPAPSP Sbjct: 76 RSPRSFLAKKLQLVRRVGAPPRRMASPPAPSP 107
>BAT2_MACMU (Q5TM26) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2160 Score = 28.9 bits (63), Expect = 7.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNR 115 S ++ P ++ + VPLAP +PP+P+P R Sbjct: 1123 SDKEAPPPKEGTLTQVPLAPPPPGAPPSPAPAR 1155
>BAT2_MOUSE (Q7TSC1) Large proline-rich protein BAT2 (HLA-B-associated transcript| 2) Length = 2158 Score = 28.9 bits (63), Expect = 7.6 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +2 Query: 17 SSRK*TPTQQRRVASVPLAPRTLASPPAPSPNRIRPA 127 S ++ P ++ + VPLAP +PP+P+P R A Sbjct: 1118 SDKEAPPPKEGVLGQVPLAPPQPGAPPSPAPARFSTA 1154
>DYNA_RAT (P28023) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1280 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 4 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 99 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>DYNA_MOUSE (O08788) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) Length = 1281 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 4 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 99 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157
>YACF_SHIFL (Q83MF4) UPF0289 protein yacF| Length = 247 Score = 28.5 bits (62), Expect = 9.9 Identities = 12/33 (36%), Positives = 23/33 (69%) Frame = +3 Query: 330 PGVQRLALESMRQEVRSATSSMTSVPKPLRFLR 428 PGV + +E++ Q++++A S + S P+ +FLR Sbjct: 81 PGVDQSRIEALIQQLKAAVSVLISAPRIGQFLR 113
>DYNA_HUMAN (Q14203) Dynactin-1 (150 kDa dynein-associated polypeptide)| (DP-150) (DAP-150) (p150-glued) (p135) Length = 1278 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/32 (40%), Positives = 19/32 (59%) Frame = +1 Query: 4 SKAEILQKINPHAAAPSRLRTTRPPNPSQPAS 99 +K L+ + P A +R TTR P P++PAS Sbjct: 126 AKTSKLRGLKPKKAPTARKTTTRRPKPTRPAS 157 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,206,654 Number of Sequences: 219361 Number of extensions: 548793 Number of successful extensions: 3015 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 2783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3000 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
